KEGG   Ipomoea nil (Japanese morning glory): 109159680Help
Entry
109159680         CDS       T04663                                 

Definition
(RefSeq) non-specific phospholipase C2
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00562  Inositol phosphate metabolism
ini00564  Glycerophospholipid metabolism
ini00565  Ether lipid metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109159680
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109159680
   00565 Ether lipid metabolism
    109159680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ini02042]
    109159680
Enzymes [BR:ini01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     109159680
Bacterial toxins [BR:ini02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   109159680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 109159680
NCBI-ProteinID: XP_019163310
Position
Un
AA seq 532 aa AA seqDB search
MLLKRRNKLSLPAAFLLFSVIPYALFAAETSPASSPIKTVVVLVMENRSFDHMLGWMKQK
VNPAIDGVDGSESNPVSTTDPNSPRLFFGNRSHFVDPDPGHSFQAIREQIFGSNETSADP
PPMNGFVQQAASMDPNMSGSVMNGFDPDMVGVYKALVSEFAVFDRWFASVPASTQPNRLY
VHSGTSHGATSNVASLLAKGYPQRTIFENLDDAGVDFGIYYQNIPATLFYRNLRKLKYLG
KFHPYSLSFKSDAKNGKLPGYVVVEQRYIESKVEAANDDHPSHDVYEGQMLVKEVYETLR
ASPQWNQTLLLITYDEHGGFFDHVPTPVRGVPSPDGIVGPDPFYFKFDRLGVRVPTIAIS
PWIEKATVVHGPNGSPFPNSEYEHSSIPATVKKIFNLPSPFLTRRDAWAGTFDSILQKRK
EPRTDCPAQLPIPKKMRQRGPNLDAKISEFQQELVQLSAVLNGDYLLTSYPENIGKGMTV
RQGKIYIESAVKRFFEAGLAAKKMGVDGDQIVQMRPSLTTRSSKPSSSQYHP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcaaaaggcggaataagctttcgcttcccgccgcctttctgctcttttccgtt
atcccttacgcgctttttgcggcggagacgtctccggcgtccagtccgattaagactgtt
gtggtgctggtaatggagaaccgctccttcgatcatatgctgggatggatgaagcagaag
gttaatccggcgattgacggcgtcgatggctctgagtcgaacccggtctccacaactgac
ccgaattcgccgcggttgttcttcggtaatcggtctcatttcgtggatccggaccccggc
cactcgttccaggcaatccgcgagcagatcttcggatccaatgagacttccgcggatccg
ccgccgatgaacggcttcgttcagcaagctgcgtccatggacccgaatatgtccgggagt
gtgatgaacgggttcgacccggatatggtcggggtatacaaggcattggtgtcggaattc
gcggtgttcgaccggtggttcgcctccgtcccggcctccacccagcccaaccgcctctac
gtccactccggcacctcccacggcgccacctccaacgtcgcttccctcctagcaaaaggc
tatccgcagcgcaccatcttcgaaaacctcgacgacgccggcgtagatttcggaatctac
taccagaacatcccggcgacactcttctaccggaacctgaggaagctcaagtacttaggc
aaattccacccctacagtttatccttcaaaagcgacgcgaaaaacgggaagttgccgggc
tatgttgtggtggagcagcggtacatagagtctaaggtggaggcggccaacgacgatcac
ccatcgcacgatgtgtatgaggggcagatgctagtgaaggaggtgtacgagacgctgagg
gccagcccgcagtggaaccaaactcttctccttataacgtatgatgagcatggcggattc
tttgatcatgtccccacgcccgtgcgtggggtccccagccccgacggaattgtgggcccc
gacccattctatttcaagttcgatcgcttgggagttcgggtccccaccatcgccatctcc
ccttggatagagaaagccaccgttgttcatgggccaaatgggtctcccttccctaactcg
gagtatgaacattcatctattccggcgacggtgaagaagatcttcaacctgccgtcgccg
tttcttacccggagggatgcatgggcaggcaccttcgactccattcttcagaaacggaag
gaacctagaactgattgcccagctcaactaccaattccaaaaaagatgagacagagaggg
ccaaacctagatgcaaagataagcgaattccagcaagaactagtacagctctccgccgtc
ctcaacggagactatctcctaacaagttatccggagaacataggcaaaggaatgacggta
agacaaggcaaaatctacattgaatctgccgttaaacgcttcttcgaggctggcctcgcg
gcaaagaaaatgggagtcgacggtgaccaaatcgtccaaatgcgaccctctctcaccaca
agatcctcaaagccttcgtcctcgcaatatcatccttag

DBGET integrated database retrieval system