KEGG   Ipomoea nil (Japanese morning glory): 109161159Help
Entry
109161159         CDS       T04663                                 

Definition
(RefSeq) glutathione S-transferase U17-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00480  Glutathione metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109161159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ini02000]
    109161159
Enzymes [BR:ini01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109161159
Transporters [BR:ini02000]
 Other transporters
  Pores ion channels [TC:1]
   109161159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 109161159
NCBI-ProteinID: XP_019165054
Position
Un
AA seq 225 aa AA seqDB search
MASEDVKLLGGWPSPFVLRTRIALNIKSVAYEFLEEKFGAKSELLLKMNPVYKKIPVLVH
NGKPICESLITVQYIDEVWTSGPAILPADPYDRATARFWATYIDDKLFPNMRAIAGAKEE
EAKKAAVGEVFSGLGLLENAFQSSSKGKKFFGGDAIGYLDIALGCLLGWIRVTELFSGIT
LLDATKFPGLAKWADDFCADSAVKDVMPPTDKLAEFAKMVFSAAK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaggatgtgaagctgttgggtggatggcccagcccgttcgtgctccgaacc
cgaattgctctcaacatcaaatccgtcgcctacgagtttctcgaggagaagttcggagcc
aagagcgagctcctcctcaaaatgaacccggtttacaagaagatccctgttctcgtccac
aacggaaagcccatctgtgaatccctcatcaccgttcagtacatcgatgaagtctggact
tccggccccgccatcttgcccgccgatccatatgatcgcgccaccgcccgcttctgggca
acttacattgatgacaagttgttcccaaatatgcgagcaatagcgggagccaaggaagaa
gaagcgaaaaaggcagcagtgggtgaagttttctccggcttaggattgctggaaaacgcg
ttccagagcagcagcaaaggcaagaaattcttcggcggggacgccattgggtaccttgac
attgcgctggggtgcttactaggctggatcagagtgacggagctcttctccggcataacg
ctcctggacgccaccaagtttcccggtctggccaagtgggccgacgatttctgcgccgat
agcgccgtcaaagacgtcatgccgcccaccgacaagctagcggagttcgccaagatggtc
ttctcagccgcaaaataa

DBGET integrated database retrieval system