KEGG   Ipomoea nil (Japanese morning glory): 109164129Help
Entry
109164129         CDS       T04663                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00450  Selenocompound metabolism
ini00970  Aminoacyl-tRNA biosynthesis
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109164129
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109164129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ini01007]
    109164129
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ini03016]
    109164129
Enzymes [BR:ini01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109164129
Amino acid related enzymes [BR:ini01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109164129
Transfer RNA biogenesis [BR:ini03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109164129
 Prokaryotic type
   Other AARSs
    109164129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e Viral_protease
Motif
Other DBs
NCBI-GeneID: 109164129
NCBI-ProteinID: XP_019168455
Position
Un
AA seq 745 aa AA seqDB search
MGEVSEKVPKVPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIY
ICGTDEYGTATETKALEENSSPQQICDKYHEIHKQVYQWFDISFDKFGRTSTPQQTEVCQ
SIFKKLLDNNWLTENTIQQPYCDTCKKFLADRLVEGTCPTPGCNYDSARGDQCEKCGKLL
NPTELKEPRCKVCRNTPCIKDTDHLFLELPLLKDKLESYVNSMSVAGGWSQNAIHTTHAW
LREGLKSRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITSCYTAEWEKWWKNPEN
VELYQFMGKDNVPFHTVIFPSTLFGTGENWTFMKTISVTEYLNYESGKFSKSKGIGVFGN
DVKDTTIPVEVWRYYLLANRPEVSDTLFTWTDLQAKLNSELLSNLGNFINRVLSFIAKDP
ASGYGSVIPDAHGVESHSSTKALAEKVGNYLDQYIEAMEKVKLKQALKIAMSLSGEGNAY
LQESQFWKLYKEDKPSCSVVMRTAAGLVYLLAFLLEPFMPSFSREVFKQLNLPESWLSLS
DENGDIERAKKPWDILPAGHKIGTPVPLFKELKDEEVEMYREKFAGSQADRTLRVEAEAK
KITEQLNKAKISNEKIKKERSTKSAEAKAKAGASVSAEAEVSISRLDIRVGLIKKAQKHP
DVDSLYVEEIDVGEAQPRTVVSGLVKYIPLEEMQNCKVCVLCNLKPATMRGIKSHAMVLA
ASNNDHTKVCGDLLLGLKEFIILSF
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagttagcgagaaagttccgaaagtgccaatcccaggcaaaagaaatatccta
atcactagtgcgctgccttacgtcaacaacgtccctcatctcggcaatatcatcggctgt
gtgttgagtgccgatgtgtttgctcggtattgtaggctcagaggctacaatgccatatac
atatgcggaacggatgagtacgggacagccactgagacgaaagccttggaggagaattct
agtcctcagcaaatatgcgacaaatatcatgaaatccataaacaagtctatcaatggttt
gacataagttttgataagtttggacggacatccactcctcaacaaactgaggtttgccag
tccattttcaagaaactattggataacaactggcttactgagaatacaatacagcagcct
tactgtgatacatgcaaaaagtttttagctgaccgccttgtagagggtacctgtccaaca
ccgggttgtaactatgattctgcacgaggagatcaatgtgaaaagtgcgggaagctttta
aatcctacagaactaaaggagccaagatgcaaggtctgccgtaacaccccatgcattaaa
gatacagaccacttgttccttgagctccctttgctgaaggataaattagagagctatgta
aacagtatgtcagtggctggaggatggagtcagaatgctattcacacaactcatgcatgg
cttagagaagggctgaagtcaaggtgtatcactagagatttgaaatggggggttccagtt
ccacatgagaaatacaaggacaaggttttctatgtatggtttgatgcacctattggttat
gtatccatcacttcatgctacacagctgaatgggagaaatggtggaagaatcctgaaaat
gtggagctgtatcaatttatgggcaaggacaatgtgccttttcatactgtaattttccca
tctacactttttggaactggtgaaaactggacttttatgaaaactatcagtgttactgaa
tacttaaactatgaatcagggaagttttcaaaaagtaaaggtataggagtctttggaaat
gatgtgaaagatacaactattcctgtagaagtatggagatactacttgctggcaaatagg
ccagaggtatcggacacattatttacatggacagatttacaggcaaagttaaatagtgaa
ttattaagcaatcttgggaacttcattaatcgtgtcttgagtttcattgcaaaagatcct
gcttctggatatggttctgtaattcctgatgctcatggtgttgaatctcattcctcaact
aaggctttagcagagaaggtcggaaactatttggatcaatatattgaagccatggaaaag
gtaaaattgaagcaagccttgaagattgccatgtctctttctggtgaaggaaatgcttat
ttgcaagagagccaattttggaagctttacaaggaagataaaccttcatgttccgtagtt
atgagaactgctgctggtctagtttatctactcgctttccttttagagccttttatgcct
tctttttcacgtgaggtattcaagcagttaaacttgcctgaatcatggctttcactttct
gatgaaaatggtgacattgaaagggctaaaaagccctgggatattttacctgctggtcac
aaaattggaacacctgtgccattattcaaggaattgaaagatgaagaagttgaaatgtac
cgggagaagtttgctggaagtcaagctgacaggaccttgagggtagaagctgaagcaaag
aagattactgaacaattgaataaagcaaaaatttcaaatgaaaaaataaagaaggaacga
tcaacaaaatcagctgaagccaaggcgaaggctggagcatctgtctctgctgaagctgaa
gtatccattagcagacttgatatccgtgttggtcttataaagaaagcccaaaagcatcct
gatgttgattctctgtatgtagaagagattgatgttggtgaagcacaacctaggactgtt
gttagtggcctagtcaaatatattccacttgaagagatgcagaattgtaaggtctgtgtt
ctttgcaacctgaagccagcaaccatgaggggtattaaatctcatgcaatggttcttgct
gcttctaacaatgatcatactaaggtatgtggtgatctacttttggggttaaaggaattt
atcattcttagtttttag

DBGET integrated database retrieval system