KEGG   Ipomoea nil (Japanese morning glory): 109164735Help
Entry
109164735         CDS       T04663                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic-like
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00860  Porphyrin and chlorophyll metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    109164735
Enzymes [BR:ini01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     109164735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 MTS PrmA Methyltransf_18 Ubie_methyltran Methyltransf_32 TehB CMAS Methyltransf_9
Motif
Other DBs
NCBI-GeneID: 109164735
NCBI-ProteinID: XP_019168830
Position
Un
AA seq 316 aa AA seqDB search
LTLSLFSTFNVTSNFRFPSKITKPARRTVIASATGGSGVTPPFNGTVIAAIGGSSVAALA
AVFLLADPDGRRRMQAETVGGDDKEVVKEYFNSNGFQRWKKIYGETDDVNKVQLDIRLGH
SRTVENVMKMLTDEGPLQGVTVCDAGCGTGCLSIPLAKEGAIVSASDISAAMVAEAEKQA
KEELLKGFDGTRPTSVMPKFEVKDLESLGGKYDTVVCLDVLIHYPQVKADAIIAHLASLA
DNRLILSFAPKTFYYDLLKRIGELFPGPSKATRAYLHAEADVERALARVGWRIRKRGLIT
TQFYFAKVVEALPALG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
cttactctttctctgttctctaccttcaatgtcacctcaaactttcgattcccttcaaaa
atcaccaaacctgctcggagaaccgtcattgcctctgccaccggcggctccggcgtgaca
ccgccgttcaacgggaccgtaatcgctgctattggcggaagctcggtagctgcgttggct
gcggtgttcctgctagctgatcccgacgggcggcggcggatgcaggcagagacggtcggc
ggcgacgacaaggaggtggtgaaggaatacttcaacagcaatggattccagaggtggaag
aagatatacggagaaaccgacgatgtgaataaagttcagttggacattagattggggcat
tctagaactgtggagaatgtgatgaagatgttgactgatgagggccctctacagggagtt
acagtctgtgatgcaggttgtgggaccggatgtttatcgattccgttggcgaaagaaggc
gcaattgtatccgccagtgatatctctgctgctatggttgctgaggctgagaaacaggca
aaagaagagcttttaaaggggtttgatggtacgcgtcctacatcagttatgcctaagttt
gaagtgaaggacttagaaagtttaggtgggaaatatgacacggttgtgtgtttggatgtt
ttgatacattacccacaagttaaggctgatgcaataatcgctcatcttgcttcattagct
gataatcgcttaatactgagctttgctccaaaaacattttactatgatctcttgaagaga
attggagagttgttccctggaccttcgaaggctacaagggcatatctccatgctgaggct
gatgtggagcgagcattggcaagagttgggtggaggataaggaagagaggtttaataacc
acacaattttattttgcaaaggttgttgaggctctccctgctttaggatga

DBGET integrated database retrieval system