KEGG   Ipomoea nil (Japanese morning glory): 109165558Help
Entry
109165558         CDS       T04663                                 

Definition
(RefSeq) probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00906  Carotenoid biosynthesis
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Module
ini_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    109165558
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     109165558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 109165558
NCBI-ProteinID: XP_019169920
Position
Un
AA seq 592 aa AA seqDB search
MAYATPSNFNPWAIQRFSSSSSSSTVDLGLPSKSISMKKPTRRAKIHCEAAVHSSSVVTL
PEQQLPDGESPAPSQPKWNLLQRAVAAALDVAEGALVSRELQRPLPKTWDPGVQIAGNFA
PVPEQAVRNNLPVDGAVPDCINGVYVRNGANPLFRPKAGHHLFDGDGMVHAVTITGGSVS
YSCRFTETERLVQERGLGRPVFPKAIGELHGHSGLARLLLFYARGLFGLVDHRRGTGLAN
AGLVYFNGRLLAMSEDDLPYHVRVKPSGDLETVGRYDFNDQLKSTMIAHPKVDPESGEFF
ALSYDVIQKPYLKYFNVKSSGEKSPDVEIPLDVPTMIHDFAITENYVIIPDQQVVFKLQE
MIRGGSCVIYEKKKKSRFGILKKTAKNAEGIIWVESPETFCFHLWNAWEEAETDEIVVIG
SCMTPPDSIFNECEENLKSILSEIRLNLKTGESTKRPIIPATDQQVNLEAGMVNRNLLGR
KTQYAYLAIAEPWPKVSGFAKVDLSTGEMQKFMYGDGKYGGEPFFVPRNPNSEKEDDGHI
LSFVHDEKTWKSELQIVNAINLELLATIKLPSRVPYGFHGTFITSYDLQNQV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgctacaccttccaatttcaatccatgggctattcaacggttttcttcttct
tcttcttcttcaacggttgatttgggccttccctctaagtcaatctccatgaaaaagccc
actaggagggccaagattcactgcgaagcggcggtgcactcttcttccgtggttacttta
cctgagcagcaattgccggacggggaatctccggcgccgtcgcagcccaaatggaacctc
ctccagcgagctgtggccgcggcgctggacgtggcggagggcgcgttggtctcacgcgag
cttcaacgaccgctcccgaaaacttgggaccctggcgtacaaatcgccgggaatttcgct
cccgttccggaacaggcggtacggaacaacctccccgtcgacggcgccgtccctgactgc
attaacggcgtttacgtccggaatggcgccaacccgctcttccggcccaaggctggccac
cacttgttcgacggcgacggcatggtccacgccgtcacaattaccggcggttccgttagt
tacagctgccggttcacggagaccgagcggctggttcaagaaagaggattgggccggccg
gttttccccaaagccatcggcgaactccatggccactccggtttagcgaggctgcttctc
ttctacgcccgcggcctctttgggctcgtcgatcaccgccgcggcaccggtctggcgaac
gccggtctagtctattttaacggtagactgctcgcaatgtccgaagatgatcttccttat
cacgtccgggttaagccttccggcgacctcgaaaccgtcgggagatacgatttcaacgat
cagctcaaaagcacgatgatagctcaccccaaagtcgacccggaatccggcgagttcttc
gcgttgagttacgacgtcattcagaagccttacttgaagtacttcaacgttaaaagttca
ggggagaagtcgccggacgtggaaatcccacttgacgttccgacgatgattcacgacttc
gcgatcacggaaaattacgtcatcatcccggaccagcaagtggttttcaagctccaagaa
atgatcagaggcgggtcctgtgtgatatacgagaagaagaagaagtcccggttcggaatt
ctcaagaaaaccgctaaaaacgcagagggtattatctgggtggagtcgccggaaactttc
tgtttccacctctggaacgcctgggaagaggcggaaaccgatgaaatcgtcgtgataggc
tcgtgcatgacacccccagattcgattttcaacgaatgcgaagagaatctgaagagcatc
ctatcggaaatccggctaaatctgaaaaccggggagtcgacgaagaggccaattattccg
gctacagatcagcaggtgaacttagaagccggaatggtgaaccggaacctgctgggccgg
aaaacccagtatgcatatcttgcgattgcggagccatggcctaaagtttctggttttgct
aaagtggacctctcaaccggagaaatgcagaagtttatgtatggagatgggaaatatgga
ggagagccatttttcgtgcccaggaatccgaattcagagaaggaagacgatggacacatt
ctttcatttgtacatgacgagaagacatggaaatctgagctgcaaattgtgaatgccatt
aacttggagttgttggccaccatcaagcttccttcaagagtgccctatggctttcatggg
actttcatcacttcatacgacctgcaaaatcaagtatga

DBGET integrated database retrieval system