KEGG   Ipomoea nil (Japanese morning glory): 109168444Help
Entry
109168444         CDS       T04663                                 

Definition
(RefSeq) probable protein S-acyltransferase 23
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ini04131]
    109168444
Enzymes [BR:ini01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109168444
Membrane trafficking [BR:ini04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    109168444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_2 Ank_5 Ank_4 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 109168444
NCBI-ProteinID: XP_019173016
Position
Un
AA seq 541 aa AA seqDB search
MASEIEVVSDPNDQKSPAQQNPSEVVVFDVHSASAYGDLQKLRNFVEHDGASLSHPDGNG
YYPLQWAALNNFADIVQYIIEHGGDVNAKDHTGQTALHWSAVRGSIAAADILLQNGARVE
AADVNGYRAVHIAAQYGQTTFLYHIVTKYLADFDVPDNDGRSPLHWAAYKGFTDTVRLLL
FRDASQVRQDKDGCTPLHWAVLRGNIEACNVLVHAGTKQELAVKDKTGCTPAKIASDKGY
RHIALLLTNVERTQSKRGKGNCCSRIGGDNGYAPILFSVVAINIILFIGSVIVAPNLPKA
TAVVALWGWIGVSMGVAALLMLVRCTSKDPGYIKTGTSKHSDSEDPLLNIDLSNSSIWIG
NWSQLCPTCKIIRPLRSKHCTTCNRCVEQFDHHCPWISNCVGKRNKRDFFIFLCMGTLTS
LIGAVVAVHRIWIPVLASGDDGSWLHRVVSEHPGLFAFLFMDAVIFIAAFTLFAVQTYQI
GRNITTNEQANARRYGYLHGPDGRFRNPYNYGCLKNCSDFLIHGYTNDNEIAWPPLPQAV
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgaaatcgaggttgtgtcggaccccaacgatcagaagagccccgcccaacaa
aaccctagcgaagtagtcgtgttcgatgtgcactccgcttctgcctatggagacttacag
aagctccggaacttcgtcgagcacgacggcgcttccctatctcacccggacgggaatggc
tactatccccttcagtgggctgctctcaacaacttcgccgacatcgtgcagtatataatt
gagcatggaggtgatgtgaacgctaaggatcataccgggcagactgccttgcattggtct
gctgttcgtggttcgattgctgcggcagatattttgttgcagaatggggcacgggttgag
gcagctgatgttaatggctatagggcagttcacatagctgctcagtatggacaaacaact
tttctttatcacatagtcacaaagtatcttgctgactttgatgtaccggataacgatgga
aggagccctcttcactgggctgcatacaagggatttactgatacagttcggttacttctg
ttcagagatgcctcccaagtcagacaagataaagatggatgcacccccttgcattgggct
gtattaagaggaaatatagaggcatgcaatgtacttgtacacgcgggtacgaaacaggaa
ttggcagtaaaagataaaactggatgtacaccggcaaaaattgcatctgacaaaggttat
cggcacatcgcccttttacttactaatgtagaacgcacacagagcaagcgagggaaaggc
aattgttgttcacgaataggaggcgataatggttatgcccccattttattcagtgtagtt
gcaattaatatcattcttttcatcggttctgttatcgttgctcctaatcttccaaaggcc
acagctgttgttgcactttggggatggattggtgtttccatgggagttgcagctctctta
atgctcgttcgttgtactagtaaagatccaggttatattaagacgggaaccagtaaacat
tctgattcagaggatcctttgttgaatattgatctgagtaactcgtccatttggattggg
aattggtctcaactctgccccacctgcaagataataagaccacttcggtccaaacactgc
actacatgcaaccgctgtgtggaacagtttgaccatcactgcccctggatatcaaattgc
gtgggaaagaggaataagcgagacttcttcattttcctctgcatgggtactctgacatca
ctaatcggggctgtagtcgcagttcatagaatctggatcccagtactggcatcaggagac
gatggatcatggctgcatcgtgtggtttctgagcatcctggtttatttgcttttctcttt
atggatgcggttattttcattgctgcttttactttgttcgctgtccaaacataccagatt
ggtcggaatataacaaccaacgaacaggctaatgctcgtcggtatgggtatcttcatggt
ccagatggtcggtttcgcaacccctataactatggatgtctgaagaactgctcggatttc
ctaatccacggctacaccaacgacaacgagattgcgtggccaccattgccgcaggctgtc
aggtag

DBGET integrated database retrieval system