KEGG   Ipomoea nil (Japanese morning glory): 109169003Help
Entry
109169003         CDS       T04663                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109169003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ini03041]
    109169003
Enzymes [BR:ini01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109169003
Spliceosome [BR:ini03041]
 Complex C
  Other components
   Step II factors
    109169003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE Sigma54_activ_2 AAA AAA_16 ABC_tran PhoH Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 109169003
NCBI-ProteinID: XP_019173426
Position
Un
AA seq 1165 aa AA seqDB search
MGVQVEEDGLKKLEYLSLVSKVCSELETHIGVGDKVLAEFITEMGRNCETVEEFDEKLKE
SGAEMPDYFVRTLLTIIHAILPPKPKSESGVDSKRTDKGEKFSALKIKDDRERVKELDRE
IEVETKKNQGKDEEEDRRDRDDRRDRRRDRDRDSKRKRDRGDRSERGNDAEYGSQDRDRD
NSYDRRKRRAYDEDRDDDRKNRMYRSEEPELYRVYKGRVSRVMDTGCFVQLDEFRGKEGL
VHVSQMATRRVANAKDLVKRDQEVYVKVISVTGQKLSLSMRDVDQNTGNDLLPLKKSLDD
DGLKENPSGGNMEGSRTRIGLSGIRITEDDVVVPSRRPLKRMSSPERWEAKQLMASGVLS
IKECPMFDDEGDGLLYQEEGAEEELEIELNEDEPPFLQGQSRYSVDMSPVKIFKNPEGSL
SRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSA
YDMPEWKKDAYGKALTFGQRSKLSIQEQRQSLPIYKLKKELVQAVHDNQVLVVIGETGSG
KTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTG
PETVIKYMTDGMLLREILVDESLSQYSVVMLDEAHERTIHTDVLFGLLKQLVKRRPDLRL
IVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDATLITVMQIHLTEPE
GDILLFLTGQEEIDYACQCLYERMKGLGKNVPELIILPVYSALPSEMQSRIFEPAPPGKR
KVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGR
TGPGKCYRLYTESAFHNEMSPTSIPEIQRINLGTTVLNMKAMGINDLLSFDFMDPPSPQA
LISAMEQLFTLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQ
TGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLR
RAQDVRKQLLSIMDKYKLDVVSTGKNFTKIRRAIAAGFFFHAARKDPQEGYRTLVENQPV
YIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFFKVADPTKLSKRK
RQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcaggttgaagaagacggattgaagaaactcgagtatctttctcttgtttcg
aaggtgtgctcggagctggagacgcatataggcgtcggagacaaagttctggcggagttc
atcacggagatgggccggaactgcgaaaccgtagaagagttcgatgaaaagctaaaggaa
agcggcgccgagatgccggattacttcgttcggacgctgcttacgataatccacgcaatt
cttcctcccaagcccaagtctgagtccggggtcgattccaagaggaccgataaaggtgaa
aaattttctgctttgaaaattaaagatgatagggaaagggttaaggagttggacagggag
attgaggtcgaaacgaagaagaaccagggaaaagatgaggaagaagataggcgggacaga
gatgatagacgagataggagaagagatagggatagagacagtaaacgaaaaagggatagg
ggtgatagaagcgaaaggggcaatgatgctgaatatggaagtcaggacagggacagggat
aatagttatgataggaggaaaagaagagcttatgatgaagatagggatgatgatagaaag
aataggatgtatagatcggaggaacccgaattgtatagagtgtataaggggagagtctcc
agggtaatggacacaggttgttttgttcagctggatgagttcagagggaaggaaggatta
gttcatgtttcacagatggcaactcggagggttgcaaatgcaaaagatttggtaaagagg
gatcaggaggtatatgtgaaggtaatttcagtgactgggcagaaattgagtttgtccatg
agggatgttgatcagaatactggaaatgatttgctaccactgaagaagagcttagatgat
gatggtttgaaggaaaatccatccgggggaaatatggaggggagtaggacgagaattggg
ctttccgggattcggatcacagaggatgatgttgttgtcccatcaagaaggccattgaag
agaatgagttcgccagagaggtgggaggcaaaacaactcatggcttcaggtgtcttaagt
attaaggagtgtcctatgtttgatgatgaaggggatggattgttgtatcaggaagaaggt
gctgaagaggagctcgagattgagttgaatgaagatgaaccacctttcttgcaaggccag
agtcggtactcggttgatatgtctcctgtcaagatttttaaaaatcccgagggttccttg
agtcgagcagctgcactccaatctgctttgataaaggagaggagagaagtaagggagcag
caacaaagaacaatgcttgattccatccctaaagatctaaatagaccatgggaggatcca
atgcctgagaccggtgagaggcatctggcccaagagctgaggggtgttggtttatcagcc
tatgatatgcccgagtggaagaaagatgcttatggtaaagcacttacttttggacagagg
tcaaagctttccattcaggagcagaggcagagtctacccatttacaagctgaaaaaggaa
ttggttcaagctgtacatgataaccaggtcttggttgtcattggagagacgggttcaggc
aagacaacacaagtgacacagtatctagccgaggcaggatatactacaagaggtaaaatt
ggatgtactcaaccacgtagagtggctgcaatgtcagtggcaaagagggttgccgaggag
tttggttgccggttaggggaagaagttggttacgccattcgtttcgaggattgtactggg
ccagagactgtgataaagtatatgacagacggtatgctgttgagggagatactggtggac
gagagtttgtctcagtattctgttgtaatgcttgatgaagctcatgagagaaccattcat
actgatgttctcttcggtctcttgaagcaattagttaagagaagaccagaccttcggttg
atcgtcacatctgcaactttagatgcagagaagttttctggatactttttcaactgtaac
atctttactatcccagggagaacctttccggtggagatactttacaccaagcagccagag
agtgactatcttgatgcaactttgataacagttatgcagattcacttaacagaacctgaa
ggtgatatccttcttttcttaactggtcaggaagagattgattatgcttgccagtgtctt
tatgagaggatgaaaggtctgggtaagaatgttcctgaattgataatcttacctgtttat
agtgccctgcctagtgaaatgcagtctagaatctttgagcctgcccctccagggaagaga
aaagtagttgtggctacaaatattgccgaagcttctttaacaatagatggcattttttac
gttatagatccaggttttgctaagcaaaatgtatataatccaaaacaggggcttgattca
ttggtcataacgcctatatcacaagcctcagcgaagcaaagagctgggcgtgctggacga
acaggaccaggaaagtgttaccgtctttatacagagagtgcatttcacaatgaaatgtct
cctacatcaatccctgaaattcagcgtattaaccttgggacgacagtgcttaatatgaaa
gctatgggtattaatgatcttttgtcctttgatttcatggatcctccctctcctcaagca
ctaatatctgccatggagcagctgttcactctaggagctcttgacgaagaggggctcttg
acaaagttgggtaggaaaatggctgaatttcctctggaccctccactgtccaaaatgctc
ctcgccagtgtagaccttggatgcagtgatgagattttgaccatcattgcaatgattcag
acgggtaatattttttaccgacctcgggagaaacaagcacaagctgatcagaaaagggca
aaattctttcagccagagggtgatcatctcaccctgcttgcggtttatgaagcatggaaa
gccaaaaacttttctggaccctggtgctttgaaaactttgtacaatcgcggtctttgagg
cgtgctcaggatgtcagaaaacagctcctttccatcatggacaagtacaaactggatgtt
gtgagtactggaaaaaactttacgaagataaggagggccatagctgcaggtttctttttc
catgctgctaggaaggatccacaagaagggtatagaaccttggttgagaaccagccagta
tatatacatcctagtagtgctctatttcaaaggcagccagattgggttatttatcatgag
cttgtgatgacaacaaaagaatatatgcgtgaggtcacagtgattgatcccaagtggctt
gtagagctggcaccacgatttttcaaagtggctgacccaactaaattgagcaagcgcaag
agacaagagcgcattgaacctctctatgacagatatcacgagcctaattcgtggcggttg
agtaaaaggcgtgcttga

DBGET integrated database retrieval system