KEGG   Ipomoea nil (Japanese morning glory): 109170771Help
Entry
109170771         CDS       T04663                                 

Definition
(RefSeq) vacuolar-processing enzyme-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ini01002]
    109170771
Enzymes [BR:ini01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     109170771
Peptidases [BR:ini01002]
 Cysteine Peptidases
  Family C13: legumain family
   109170771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14 TMF_TATA_bd
Motif
Other DBs
NCBI-GeneID: 109170771
NCBI-ProteinID: XP_019175471
Position
Un
AA seq 474 aa AA seqDB search
MGVSSYITFKVILVLAVLVVAVQPPPCGAATDRLSTLLRSAVDNDGEDENSGGRKWAVLV
AGSNGYWNYRHQADICHAYQILKKGGLKDENIIVFMYDDIANNKENPRKGVIINSPNGSD
VYGGVPKDYTGKEVNTENFFAVLLGNKSAVVGGSGKVLNTKPKDVIFIYYSDHGGPGILA
MPTGADLYADDFIAVLKKKHEAGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAAD
ENSSGWYCPGSDPLPPPEYTTCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNG
TGGGSHVMEYGSMDLRKDKLSKYQGYVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRL
GDEKSEMKDKVLKEMSEKMQVRAYIDGSVDAIGDYLFGTEKAHSILKSVRKTLPLVDDWE
CLRSMVKIFEEHCGALGEYGKRHMRAFANICNNGISLAAMGKASMAACDGHSAQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggggttagtagctatattacattcaaagtgatattggtgttggcggtgcttgtggtg
gcggtacagcctcctccttgcggcgctgcaactgaccggctaagcacattactccggtcg
gcggtagacaatgacggagaagatgaaaattccggcggcagaaaatgggcggttcttgtg
gccggttcaaatggctactggaattaccgtcatcaggcggatatttgccatgcatatcaa
attctgaaaaagggagggttgaaggatgaaaatataatagttttcatgtacgacgacatt
gcaaacaataaagaaaatccaagaaaaggggtgataattaatagtccaaatggtagcgac
gtgtatggtggcgtgccaaaggactacacgggtaaagaagtgaacacagagaattttttt
gcagtgcttctgggaaacaagagcgccgtggtgggtggaagcggcaaagtacttaacaca
aaacccaaagatgtcatcttcatttattattccgatcatggaggtcctggaatccttgct
atgccaaccggcgctgatctttatgccgatgacttcattgcggttttgaagaagaaacat
gaagctggaacctacaaaaagatggttatctatgtagaagcgtgcgagagtgggagtatg
tttgaaggattattgcctcatgattggaacatttacgcaatgacagcatccgctgcagat
gagaatagttcgggttggtattgtcctggttcggaccctttacccccaccagaatacacc
acgtgcttgggagatttgttcagtatttcttggatggaggatagcgatcgtcacaacagg
aagaaggagacaatctcagggcaatacgagaatgtgaagaagagaacctggaacaatgga
acagggggagggtctcacgtgatggagtatggaagcatggatttaagaaaggacaagctt
tcaaagtaccaaggatatgttctaccccccattaatgttgccaccattcccatgcctggg
actactgttcatcaaagggacgctgagcttctctacctctgggagaagtacaagagattg
ggagatgagaagtcggaaatgaaggacaaggtcttaaaggagatgagtgagaagatgcag
gtgagagcatatatagatgggagtgttgacgcaattggagattatctatttggtacagaa
aaagcccattccattctcaaatctgtcaggaaaacactccctctggttgatgattgggaa
tgcctcagatcaatggtgaagatatttgaggaacactgtggggcattgggagaatatgga
aagaggcacatgagagcatttgcaaacatttgcaacaatggcatctccttagctgccatg
gggaaggcctccatggccgcttgtgatggccatagcgctcagtaa

DBGET integrated database retrieval system