KEGG   Ipomoea nil (Japanese morning glory): 109172613Help
Entry
109172613         CDS       T04663                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109172613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ini03041]
    109172613
Enzymes [BR:ini01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109172613
Spliceosome [BR:ini03041]
 Complex C
  Other components
   Step II factors
    109172613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 IBR DEAD OB_NTP_bind AAA_22 AAA_19 zf-C3HC4 zf-C3HC4_2 AAA_30 Helicase_RecD AAA_29 RsgA_GTPase ResIII ABC_tran T2SSE
Motif
Other DBs
NCBI-GeneID: 109172613
NCBI-ProteinID: XP_019177351
Position
Un
AA seq 1740 aa AA seqDB search
MQRPGFSDTFRRNRPPEKLPYTEAGHCYRPRQPYKNQWKSHLSDRRDRSPGPPKFVIQFR
SSSRSLKRSEFNELIEKLPSPPQSSHVFERGCVLGTLFYEQWSEAVEVVVELWRIRLDGG
LPMTPSLVENAEVSSKKEELKDRLRGVFLEKLEGVMEGEVVQKCRQKLKLLEAEIEKVSK
LLGKPKRIALANELLNKKEGFVAERDLVAKRIAEFMNGVSCIVLYLEGKYSGEDVHGDST
AVFTFETEFNWDRIHHLIKRECRRLEDGLPIFASREEILKQIVSEQATVLIGETGSGKST
QLVQFLADSGVAGNGAVVCTQPRKLAAISLADRVKEECIGCYQENSIACYPSYSSSHQFD
SKVIFMTDHCLLQHYMRDKSLCKISCIIIDEAHERSLNTDLLLALLRNLLHQRHDLRLII
MSATADADQLTNYFFGCRTFYVSGRTFPVDIKYVPSECEGSFVSGSGTVPSYVSDVVRTV
TGIHKTEGEGTILAFLTSQMEVEWAIETFQAPSAIALPLHGKLSYEDQRRVFLNFPGKRK
VIFTTNVAETSLTIPGVKYVVDSGRVKESRFEPGTGMNVLKVCPVSKSSANQRAGRAGRT
EPGRCYRIYSENDFENMPCHQEPEIRKVHLGIAVLRILALGIKDVQSFDFVDAPSPIAIE
MAIRNLIHLGAIACNDDGYELTADGHYLVKLGIEPRLGKIILSCFHRHLGKEGLVLAAVM
ANSNSIFCRVGTEVDKLKSDCLKVQFSHPDGDLFTLLSVYKEWDAVSQEKKSAWCWNNSI
NAKTMRRCQETVEELEACLQNELSIVVPTYWHWDPHMHTEHDESLKHIILSSLSENVAMF
SGYDQLGYEVALAGKHVKLHPSCSLLNFCQRPTWVVFGDILASAKEYLVCVTAFDFHNLA
TLFPPPLFDFLKMDAQKLQKKSLTGFGSMLLKRLCGKSNCHINRFVSRMRTLCMDERIGI
EVNVDQNEIAMYASSRDMDRVFENLNEAVDYEYKLLKNECLEKCLYNGGSASSVPTALFG
AGAEIKHLELEKRCLTFDVFLSKGNSFDDKELLMFLERNAGDICVVHRFSGVGQDSGEME
RWGRVTFVTPNAAEHASALNSVPLSSGVVKVVPSKTMHDGDQNMNSSHLLKAKVHWPRRF
SKGVAIVKCHPKDIAFMVDDFSSVVIGRSIVRCEQSIKCSDSIVIKGLDRELSEAEIFEM
LTPLTGRNILDLFLIRGNAVEGPPLVACEEALRREISSFMPKRNPYGNSTRVQVFPPEPK
DTYIKAAITFDGSLYLEAARALEEMNGKVLPGCLPWQKIQCQHLFSSSVSCPAAVYHVIK
TQLDTLLASFRHRKGVECNLLRNENGSYRVTISAGATKIVAEVRKLLEQLMKGKIIDHDG
ITPTVLQHLFSREGIFLMKSVQQETGTYILFDRHTHTLRIFGCSNMIDMAEKKFVDLLLS
LHENKQLEVHLRGEALPPNLMKRVVQKFGADLNGIKQMFPEGNFSLNVKHHCISISGPKE
VKQKVEDVIYEMAQTSSPQNLRSDDEADCPICLCEVEEGFKLENCFHVFCRSCLVEQCES
AIRSREGFPMCCMHKGCKAPILVADLKSLLSIEKLEELFRASLGAFVAASGGSYRFCPSP
DCPSVYRAADPSATTGEPFICGACYAETCTSCHLEYHPFISCGKYREIKDDPDYNSLKAW
KKGKENVKNCPVCSFTIEKVDGCNHIECKCGKHVCWVCLDFFATSDDCYNHLRSVHSTII
NT seq 5223 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaccagggttttcagacactttccggcgaaatcggccaccggagaagcttcct
tatacggaagcgggtcactgttaccgcccgcggcagccgtataagaatcagtggaagtct
cacttgagcgaccgtcgtgatcggtctcctgggccgccgaaattcgttatacagttccgt
tcgagtagccggagcctgaagagatccgaattcaacgagctcatcgagaaattgccgtcg
ccaccgcaaagttctcatgttttcgaaaggggttgtgttttagggactctgttttatgag
cagtggagtgaggctgtggaggtggtggtggagttatggagaatccggctcgacggaggg
cttccgatgacaccgtcgctggtggagaacgcggaggtgtcgtcgaagaaggaggaattg
aaggatcggctccgaggggtgtttctggagaagctcgagggggtaatggaaggggaagta
gtgcaaaagtgtaggcagaagttaaaattgctggaggcggagattgaaaaggtctccaaa
ttgcttggaaagccgaaacgtatcgctcttgcaaatgaactattgaataaaaaggagggt
tttgtggctgagagggacttggtagcaaagaggatagcggagttcatgaatggggtgagt
tgtattgtgctttatttggaggggaaatactccggggaggatgttcatggagacagtacg
gcagtgtttacctttgagacagagttcaattgggaccgcattcatcatctgattaagagg
gaatgccgaagactcgaggatggcttgcccattttcgcttcaagggaagagattcttaag
caaatagtttctgaacaggctacagttttgattggggagactgggtctggaaagagtaca
caattggttcaattcctagctgattcaggagttgctggaaatggtgctgtagtctgcact
caaccccgaaaacttgctgccatctctttggcagatagggttaaagaggaatgtattggc
tgttaccaagaaaactctattgcctgttacccatcatattcatccagtcatcagtttgat
tcaaaggtaatatttatgacagatcactgcctgctgcagcactatatgagagataaaagt
ttgtgtaagatttcatgcattataattgatgaagcacatgaaagaagcttaaacacggat
cttcttttagcattgctaaggaatttgcttcatcagaggcatgatttaaggcttatcatt
atgtctgccacagctgatgcagatcagcttacaaattacttctttggttgtagaacattt
tatgtgtctggcagaacttttccggtggacattaagtatgtacccagtgaatgtgaaggt
agttttgtttctggttctggtacggttccttcttatgtttctgatgttgtaaggactgtg
actggtatccacaaaacagagggagagggaacaattcttgccttcctgacttctcagatg
gaagtagagtgggctattgagacttttcaagccccctctgccattgcattacctttacat
gggaaactctcctatgaagaccaacgccgggttttcctgaatttccctggaaagagaaag
gtaatattcactacgaatgttgctgagacatctttgacaattccaggtgtcaaatatgtt
gttgattctgggagggttaaagaaagcagatttgaacctggaactggcatgaatgttctc
aaggtttgtccagtcagcaaaagctcagcaaatcaacgagctgggcgagctggtagaact
gaaccgggaaggtgttatagaatctactctgaaaatgattttgagaatatgccttgtcat
caggaacctgaaattcgtaaggttcatcttggtattgctgtgctaaggattcttgccctg
ggcatcaaggacgtgcagagttttgattttgttgatgcacctagtcctatagcaattgag
atggctatcagaaatctgattcacttaggagctattgcatgcaatgatgatggttatgaa
ttaactgcagatggacattatctagtgaagttgggtatcgagcctcggttgggtaagata
atccttagttgtttccatcgccatttgggtaaagagggtcttgttcttgctgctgttatg
gcaaattcaaacagcattttctgcagagttggtactgaagtagataaactaaaatctgat
tgccttaaggttcagttttcccatcctgatggtgatctcttcactttactatctgtttac
aaggaatgggatgctgtttctcaagaaaagaaaagtgcctggtgctggaataatagcatc
aatgccaaaaccatgagaaggtgccaggagactgttgaagaactggaagcctgtcttcaa
aatgaactgagtatcgttgttccaacttactggcattgggatccacatatgcacactgag
catgatgaaagtttgaaacacattattctctcttccctttcagaaaatgtggcaatgttc
tctggttatgatcaacttggctatgaggtagcactggcaggtaagcatgtcaaattgcac
ccttcatgttcgttattgaatttttgtcaacgacctacttgggtagtttttggtgatatc
ctggcatcagctaaagagtatctggtctgtgttacggcgtttgactttcacaacctagct
actttgtttcctcctccattgtttgatttcttaaagatggatgctcaaaagctacagaaa
aagtctttgacagggtttggaagcatgctgctgaagagattgtgtggaaaatctaactgt
cacatcaatcgttttgtttcgcgaatgagaactttgtgcatggatgaacgcatcggcatt
gaagtgaatgttgatcagaatgagattgcaatgtatgcttcttccagagacatggatagg
gtttttgagaatctgaatgaagcagtggattatgaatacaagttgttgaaaaatgaatgt
ctggagaaatgtttgtacaatggagggtctgcttcttcagtgcctactgccctttttgga
gctggtgctgagataaaacatttggagcttgagaagagatgtttgacatttgatgtattt
ctttcaaagggaaattcatttgatgataaagaactgttgatgtttctggaaaggaatgca
ggtgacatttgtgtggtccacaggttctcaggtgtgggacaagatagtggggagatggag
agatggggcagggtaacatttgtcacccccaatgctgctgagcatgcttctgcactaaac
tccgtcccacttagcagtggtgtggtcaaagtagttccttccaagaccatgcatgatggt
gatcaaaatatgaactcatctcatttgctcaaagcaaaagtgcattggcctcgcagattc
agtaaaggggtagctattgtgaaatgtcatccaaaggacattgcttttatggttgatgac
ttctctagtgttgtaataggaaggagcattgttcgatgtgaacaaagcatcaaatgttct
gacagtatagtgattaagggacttgatagagagctttctgaagctgagatatttgagatg
ttaactccattgacaggcagaaatattttggatttgttcctaatcagaggaaatgctgta
gaaggtcctccattagttgcttgtgaagaagcacttcgaagagaaatatcttccttcatg
cctaaaaggaacccttatggtaactctactcgtgtccaagtcttccctcctgaaccaaag
gatacatacattaaagcagctataacattcgatggaagtctatatctagaagctgcaagg
gctctggaagaaatgaatgggaaagtattgcctggatgccttccatggcagaagatacaa
tgccagcacttgttttctagttccgtgtcctgtcctgcagcagtatatcatgtcattaag
actcagctggatactttacttgcaagcttccgtcatagaaagggtgttgagtgcaatctc
cttaggaatgagaacggttcctatagagttaccatatctgctggtgccacgaaaattgtg
gcagaagtgagaaaactattggagcagcttatgaaagggaaaataatagaccatgatggc
attactcccacagttctgcaacatttattttctcgggaagggatctttcttatgaagtca
gttcagcaggagacaggaacctatattctttttgacaggcatacccatactctgagaatc
tttggttgttcaaacatgattgatatggcagagaagaaatttgtggatttacttctgtca
cttcacgaaaacaagcaacttgaagtccatcttcgtggagaagctttgcccccaaatctg
atgaagagagtggttcagaagtttggagcagaccttaatgggatcaagcaaatgtttcct
gagggtaacttctctctgaatgtcaaacaccattgtatctctatcagcggtcccaaagaa
gtgaagcaaaaagttgaagacgtaatttatgagatggctcaaacaagtagtccgcagaat
ctaaggagtgatgatgaagctgactgcccgatttgcttgtgtgaggtggaggagggtttc
aagctagaaaactgtttccatgtcttctgccgatcatgcttggtggagcagtgcgagtct
gccatcagaagcagagaaggtttccccatgtgctgtatgcataaaggttgcaaggctccg
atcctggttgctgatttgaagtctctgttatcaatcgaaaaactggaggagcttttcagg
gcatcattaggggctttcgtggcagcaagtggaggttcttacaggttttgcccatccccc
gattgcccctcagtttatcgtgctgctgacccctcggccactaccggggaaccattcatc
tgcggtgcatgttatgcagaaacatgtacgagttgccacctcgagtaccatccgttcatt
tcatgtggcaagtaccgtgagatcaaagacgacccagactacaactctctgaaagcatgg
aaaaagggaaaagagaacgtgaagaactgccccgtctgctcgttcacaatcgagaaggtg
gatggctgcaatcacatcgagtgcaagtgcgggaaacacgtttgctgggtatgtttggat
ttctttgctacgagtgatgattgctataatcatttgaggtctgtacattccaccattata
tga

DBGET integrated database retrieval system