KEGG   Ipomoea nil (Japanese morning glory): 109173978Help
Entry
109173978         CDS       T04663                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109173978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ini03032]
    109173978
   03036 Chromosome and associated proteins [BR:ini03036]
    109173978
   03400 DNA repair and recombination proteins [BR:ini03400]
    109173978
Enzymes [BR:ini01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109173978
DNA replication proteins [BR:ini03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109173978
Chromosome and associated proteins [BR:ini03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109173978
DNA repair and recombination proteins [BR:ini03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109173978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg PADR1 WGR BRCT BRCT_2 PTCB-BRCT BRCT_3 TbpB_C
Motif
Other DBs
NCBI-GeneID: 109173978
NCBI-ProteinID: XP_019178840
Position
Un
AA seq 835 aa AA seqDB search
MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTDGGAGDEKKAE
EEDGKAADVAAAAEFEKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG
PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL
IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC
LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI
PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG
LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE
FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS
QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS
NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK
LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL
PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR
PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC
GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPEAA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcatgagacgaggtctcacacgcatcacgcaaacgacgaggagagaatggtg
accaggaaacagaaggcggatagcaagcagctgcaggatcatgatgagcccctgcacaac
tcgccgaccaagaaggcgaaaaccacggacggtggcgccggcgacgagaagaaggcggag
gaggaggacggaaaagccgccgacgtagctgcagcagccgagttcgagaagttctgtaga
gccacgagcgagcatctctccgtccaacaaatgcgccaaatcctccaagataacgcccag
gattcctccggctccgatgaaactattgttcctagatgccaagaaattatgttttacggc
ccggtggataagtgcccggtttgtggcggcgcgttggagtgcagcagcggcggaacctat
cactgtaaaggagatttctcagagtggtcgagctgctcttactccaccagaaatcctccg
agaaaggaagagcccctgagaattccagaatctgtccagaaaacgccactctcagatttg
atcaagaaacatcaagatcccaaaaaccggccgctgaaagaacaggttatcaccgttaaa
cctctaagcggtatgatgatttcgctctccggccgtctcacccgaacccatcaatactgg
aaatcgcagatcgagaagaacggagggaaagtggcaaattctgtcattggtgtgacttgt
ttagttgtctctccggccgaacgagagcgcggtggctcttctaaagtagctgaagcagtg
gagaggggtataccagtagtaagggaagcttggttggtagatagcatagagaaaaaggag
gttcagccgctagatgcatatgatgttgcgagcgacattgctgttgatggtagagggatt
ccgctcgataagcaggatccaagtgcggaggcactcgagaacattacatcagagcttaag
gtgtatggaaagaggggggtgcacaaggatactaagttgcaggatgaaggtggaaagata
cttgaaaaagacgggctgctgtacaattgtgctctttcggtttgcgatcaaggaagagga
ctcaacgatttctgcattatgcaactgattgtggcgcccgagaatcgtttgcacatgtac
tataggaagggcagagtgggggatactgcccgagtcgatgacaagctagaggagtgggaa
aacgaggatggagctatcaaagagttctctaggatctttgaagagctgacgggaaacgag
ttcttgtcccgggagagggagaagaaaattcagaagaaacctcacaaattttatcccctt
gatgtggctgatggaattgaagttcggcatggagggcttgcccttaggcaactcgggatt
gcagctgtacacagcaagctggatccgatggtagcgaattttatgaaaattctctgcagc
caagaaatctataggtacgcgttaatggagatggggtatgattacccagagattccaatc
gggatgctttctgacgtgcatctagaaagatgtgaggatacactgctccactttgtggag
aggataagatcgacgaaagaagcagggcagcaagtagaagcgttgtgggcagaattcagc
aacaaatggttcactctcatgccatctacgaggccattttatctccgggatttcgctgat
attgcagatcatgctgcttctgtgttcgagagcgtgagagatatcaacgctgcatcccgc
cttatagaagatatgtcgggttctactctcgatgatcctttgtatgatcgatacgtgaag
ttggggtgctctatttccgccttggagaaagattctgatgactacaaaatgatattgaag
tacctcgagaaaacttatgaccctgttagagttggagacataagttatggagtatcggtt
gagaatatatttgctgttgaaccaagcgcttgcccctcgctcgatgacatgaagaagttg
ccgaacaaagttcttctctggtgtggcaccagaagttcaaatctgttgaggcatttgcag
aatgggtttctgccggctgtttgttcacttccggtcccaggctatatgtttggaaaagct
attgtctgctcagatgctgcagcagaagctgctaaatatggttttacagcagtggacagg
ccagaaggcttcttagttttggctgtggcttcaatgggtgaagaaatcatggagttctcg
agtccacccgaggatactaaatccttggagcaaaagaagctcggggcgaagttccatggc
aggaagaagaccgatgaatccgagcatttcgtgtggaaggacgatatcaaagtgccttgc
ggccgcctgatagaagaatcacagcacaacaacagtccgtttgactataatgagtatgcc
gtgtatgatccacagcaggtgagcattaggttcttggtggccgtcaagtacgatgaggaa
gctgttgaatattacacagctgaaccggatgagcccgaggcggcttga

DBGET integrated database retrieval system