KEGG   Ipomoea nil (Japanese morning glory): 109174349Help
Entry
109174349         CDS       T04663                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109174349
Enzymes [BR:ini01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109174349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 109174349
NCBI-ProteinID: XP_019179135
Position
Un
AA seq 220 aa AA seqDB search
MASTPLLLPHAFAKGLSTNHQRISKAQFQCFLMKASENGGNGKELALIKRRELIGLGLGA
SAGFLMGLSSAQAAGLPPEEKPRLCDDSCEKELENVPMVTTESGLQYKDIKVGGGPSPPV
GFQVAANYVAMVPSGQIFDSSLEKGQLYIFRVGSGQVIKGLDEGLLSMKVGGKRRLYIPG
SLAFPKGLTSAPGRPRVAPNSPVVFDVSLEYIPGLEDEEE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacacctctgcttctcccacatgcatttgctaaagggttatctaccaatcat
caaagaatatccaaagcccagtttcagtgtttcttgatgaaggcctcagagaatggtggg
aacgggaaagagctcgcattgattaagcgaagggagctaattgggttgggtctgggtgct
tctgcggggttcttaatgggtttatctagtgcccaagcagccggattgccccctgaggaa
aagcccagattgtgcgacgattcttgtgagaaagagcttgaaaatgtccctatggtaact
actgagtccggtttgcaatacaaggacatcaaagttggaggcggccctagcccccctgtt
gggtttcaggtagctgctaattatgttgccatggtaccatctggacaaatctttgatagt
tctctggagaaaggtcaactttatatttttcgagtgggttctggtcaggtgatcaaggga
cttgatgaaggtctcctatccatgaaagttggtggaaaacgtcgactttacattccggga
tcattggcattcccaaaaggtctgacatcagcccctggaaggccaagagtggctcctaac
agcccagttgtatttgatgtgagtttggagtatataccaggccttgaagatgaggaagag
taa

DBGET integrated database retrieval system