KEGG   Ipomoea nil (Japanese morning glory): 109182026Help
Entry
109182026         CDS       T04663                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00071  Fatty acid degradation
ini00410  beta-Alanine metabolism
ini00592  alpha-Linolenic acid metabolism
ini00640  Propanoate metabolism
ini01040  Biosynthesis of unsaturated fatty acids
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01200  Carbon metabolism
ini01212  Fatty acid metabolism
ini04146  Peroxisome
Module
ini_M00087  beta-Oxidation
ini_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109182026
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109182026
   00592 alpha-Linolenic acid metabolism
    109182026
   01040 Biosynthesis of unsaturated fatty acids
    109182026
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109182026
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109182026
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     109182026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 109182026
NCBI-ProteinID: XP_019187584
Position
Un
AA seq 441 aa AA seqDB search
MEADPSLKVQEEMKKEAKSSYFDLPALDVSVAFPQATPAANFPPCTSDYYQFDDLLTPQE
RSVKMKVRKFMEKEVAPIITKYWEKAEFPFEIIPRIGGLHVVGGSLKGEYGCPAFSITAS
AIVFAEVARVDASLSVFVLVHDYLAMRTIGVCGSEIQRQKYLPSMAKLQSVGCLGLTEPD
YGSDASALRTTAKKVEGGWILEGQKRWVGNSTFADILIIFARNTTTKKINAFIVKKDAPG
LQATKIENKIGMRVVQNGDILLNKVFVPDEDRLPGVNSFQDTKKVLAASRLMVAWQPIGI
SMGVYDVCHRYLKERKQFGAPLAAYQLSQQKLVKMLGNIQGMFLVGWRLCKLYETSKMTD
GQASLGKAWITLKARETVALGRELLGGNGNLADFHIGKAFCDMESVYTYEGTYDINTLVT
GREITGISSFKPATLSTGSRL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgatccatccttgaaagttcaagaggaaatgaagaaagaagcaaaaagctcg
tattttgatttaccagcactggatgtttctgttgcatttcctcaggcaactccagcagca
aattttcctccttgcacttctgattactatcagttcgatgacctattgactccccaagag
cgatccgtcaaaatgaaagtgagaaaattcatggaaaaagaagtagcacctataatcaca
aaatactgggagaaggcagagtttccgtttgaaataattcccagaattgggggtttgcat
gtggttggtggcagtctaaagggggagtatgggtgtcctgctttctccataactgcaagt
gccatcgtgtttgcagaagttgctagagttgatgcaagcctctctgtattcgttttggtt
catgattatttggcaatgcgtaccattggagtatgtggatctgagattcaaaggcagaag
tatttgccatccatggccaaacttcaaagtgtgggttgtttgggtctgacagaaccggac
tacggaagtgatgcaagtgctttgagaacgaccgcaaagaaggttgaaggtggttggatc
cttgaaggccaaaagcgttgggttggaaacagcacttttgcagatatacttattattttt
gctagaaacaccactactaaaaagatcaatgcattcatagtaaagaaagatgctccaggg
ttgcaagctactaaaatagagaataaaattggcatgagagttgttcaaaatggagatatt
ctcttaaacaaagtatttgtaccggatgaggatagactcccaggtgtaaattctttccag
gatacaaaaaaggttcttgctgcttctcgtctcatggttgcatggcaacctattggcatt
tcaatgggtgtttatgatgtgtgccacaggtacttgaaagagaggaagcagtttggagct
ccattggcagcttaccaactgagccagcagaagttggtaaagatgttgggaaacattcag
gggatgtttctggtcggttggcgcctctgcaagttgtatgaaactagtaaaatgacagac
ggtcaagctagcctgggcaaagcatggattaccttgaaggcaagggaaactgttgctctt
gggagggagttactaggtggcaacggaaacttggctgactttcacatcggaaaggcattt
tgcgacatggaatcagtgtatacatatgaaggtacctacgacattaacactctagtaaca
gggagagaaataacgggtatttctagtttcaaaccagctactttgagcacagggagtcgc
ctttag

DBGET integrated database retrieval system