KEGG   Ipomoea nil (Japanese morning glory): 109182400Help
Entry
109182400         CDS       T04663                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00270  Cysteine and methionine metabolism
ini00480  Glutathione metabolism
ini01100  Metabolic pathways
Module
ini_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    109182400
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109182400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ini04147]
    109182400
Enzymes [BR:ini01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     109182400
Exosome [BR:ini04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109182400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 109182400
NCBI-ProteinID: XP_019188128
Position
Un
AA seq 559 aa AA seqDB search
MGAGHSWCSSDSLSSLHSTTTSFPSPTALYSFKSHSTVFPLHSFPRILQTHIPKSAHIAM
SQSPSATPLPLNSSRPETHDEEGSVDAILDPHNIHPNLLQTLSYDALVWSSLHGLLVGDR
NSQRSGSVPGVGLVHAPFALLPTSFPEGHWKQACEVAPIFNELVDRVSQDGEFLQETLSR
TKKVDDFTSNLLDIHSKMLEINKKEEIRLGLHRSDYMLDEQTKLLLQIELNTISSSFPGL
SCLVSELHRSLLQQHRKHLALDPDKIPQNNAGVRFVEALAKAWNEYNNPGAVVMFVVQTE
ERNMYDQHWLSSVLQERHHITTIRKTLAEIDALGELLPDGTLVVDGQVIAVVYFRAGYAP
GDYHSESEWRARLLMEQSCAVKCPSISYHLAGTKKVQQELAKPNVLERFLENKDDISKLR
KCFAGLWSLDESDVIKDAIQRPELYVMKPQREGGGNNIYGDNVRETLEKLQKEGTGSDAA
YILMQRIFPALSPAILMREGIPHKEQAISELGIYGAYLRNKREVVINENCGYLMRTKVSS
SNEGGVAAGFAVLDSIYLV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggccactcgtggtgctcttctgattccctttcttctctgcacagcacaacc
acttccttcccctcccccactgctctttatagtttcaaatcacattcaaccgtctttccg
cttcactctttccccagaatcttgcaaacccatattccaaagtctgcccatattgccatg
tctcaatctccatcggcaacacctttgccattgaatagtagcaggcctgagacccacgat
gaggaaggttcggttgacgccattcttgatcctcacaacattcaccccaatttgctccag
actctgtcgtacgatgctcttgtctggagttccctccatggtctccttgttggtgacaga
aattctcagagatcaggaagtgttcctggtgtgggtttagttcatgctccatttgcctta
ttgcccacatcatttcctgaaggtcattggaaacaagcttgtgaagttgctcctattttt
aatgaactggttgatcgtgtgagccaggatggagaatttctacaggaaacactctccaga
acaaagaaagttgatgatttcacatccaacctcctagatatccattctaaaatgttggag
attaataagaaagaggaaatacgcttggggttacaccgttcagattatatgctagacgaa
caaactaaattacttctgcaaatagagctcaatacaatttcttcatcatttcctggacta
agttgtcttgtcagtgagcttcacaggagtttacttcagcagcataggaaacatcttgca
ttagatcctgacaaaattccccaaaacaatgctggggttcggtttgttgaagcactagct
aaagcttggaatgaatataacaaccccggggctgtagttatgtttgtggttcagactgaa
gagcggaacatgtatgatcagcattggctttcttcagtactgcaagaaagacatcatatt
acaactatccggaagacactagcggagattgatgcacttggagagcttttacctgatggt
acacttgtcgtagatggtcaagtcattgcagttgtttattttagagcaggatatgctccc
ggtgattaccactctgaatctgaatggagagcaaggcttcttatggagcagtcctgtgct
gttaagtgcccttcgatttcgtatcatttagcaggtaccaagaaagttcagcaagagctt
gcaaagcccaatgttctcgagaggtttctagaaaacaaagacgacatttccaaattgcgg
aaatgctttgccgggctgtggagccttgacgagtcagatgtcattaaggatgcaattcaa
agacctgaattatatgttatgaaacctcaacgagaaggaggagggaacaatatctacggg
gacaatgtgagagaaactcttgagaagttgcagaaagaaggcaccggaagcgatgccgct
tacatcctcatgcagaggattttcccggccttgtctccagcgattttgatgcgagagggc
attcctcacaaagagcaagccatatctgaactcggtatatatggtgcttatttaaggaat
aaaagggaggtggtaataaacgagaattgtggttacctgatgcggacaaaggtgtcttct
tcaaacgagggcggggttgcagctgggtttgcggttttagacagtatatatttggtttga

DBGET integrated database retrieval system