KEGG   Ipomoea nil (Japanese morning glory): 109182806Help
Entry
109182806         CDS       T04663                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109182806
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     109182806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 109182806
NCBI-ProteinID: XP_019188554
Position
Un
AA seq 626 aa AA seqDB search
MQLSNSDLYTIYTPYRSIELQIKALNMDVAVGNFEGSQPNNGDVVCPNGGVSAVSPPTTT
PPDATLGRHIARRLVEIGVRDVFTVPGDFNLTLLDHLIAEPSLNNIGCCNELNAGYAADG
YARQRGVGACVVTFTVGGLSVLNAIAGANSENLPVICLVGGPNTNDYGTNRILHHTIGLA
DFSQEFRCFQTVTCYQALINHLDDAHEQIDTAISTALKESKPVYVSISCNLAGIPHPSFS
REPIPFNISPRLSNKLGTEAAVEAAAAFLNKAVKPVMVGGPKLRVAKACEAFVEFADASG
YPIAVMPSGKGLVPEQHPHFIGTYWGAVSTAFCGEIVESADAYLFAGPIFNDYSSVGYSL
LLKKEKAVIVHPDRVVIGNGQTFGCVLMKDFFTELAKKIKKNNTAYENYSRIYISEGSPL
KSLPTDPLRVNIMFQHIQKMLSSDTAVIAETGDSWFNCQKLKLPTGCGYEFQMQYGSIGW
SVGATLGYAQSVPSKRVIACIGDGSFQVTAQDISTMMRCNQKTIIFLVNNGGYTIEVEIH
DGPYNVIKNWNYTGLVDAICNGEGKCWTTKVFTEEDLIKAIETATGEKADCLCFIEVIVH
KDDTSKELLEWGSRVASANGRPPNPQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaagcaattctgatctctatactatatatacaccgtaccgatcgatcgagctg
caaattaaagcattaaacatggacgttgcagtaggaaactttgagggatcccagcccaac
aacggagacgtggtttgccccaacggcggtgtttccgccgtttctccgcccaccaccacc
ccgccggacgccaccctgggccgccacattgcccgtcggctggtggagataggcgtgaga
gacgtgttcacggtgccgggagacttcaacctgacgctgctggaccacctgattgcggag
ccgagtcttaacaacattgggtgctgcaacgagctgaatgcggggtacgccgccgacggc
tatgccaggcagcggggagtcggcgcttgcgtcgtcaccttcacggtgggcgggcttagc
gtgcttaacgccattgccggtgctaatagcgagaaccttcccgtgatttgtttggtgggt
gggcctaatactaacgattatggaactaataggattttgcatcacaccattggattggct
gattttagccaggagttcaggtgcttccagactgttacttgctatcaggctttgatcaac
cacttggatgatgcgcatgaacaaattgatacagcaatctccacagctctcaaagaaagc
aaacctgtgtatgtgagtataagttgcaaccttgctggcattcctcatccaagtttcagc
agggagcccattccatttaacatttcacccagattgagcaataagttggggacagaggcg
gctgtggaggcggcagccgccttcctgaacaaggcggtgaagcccgtgatggtgggaggg
ccaaagctgagagttgccaaggcctgcgaggctttcgtcgagttcgctgatgctagtggc
tatcctatagcagtgatgccctccggcaaagggctagtcccggaacagcaccctcatttc
atcggcacctactggggtgcagtgagcactgccttctgtggagaaatcgtcgaatctgca
gacgcttatctgtttgccggaccaatctttaacgactacagctctgtcggttactccctc
ctcctcaagaaggagaaggcggtcatcgtgcaccctgacagagttgtgattgggaacggt
cagactttcggatgcgtgctcatgaaagatttcttcacggagctagcgaaaaagattaag
aaaaacaacactgcttatgagaactattcccggatctatatttctgaagggagtcctctc
aaatccttgcccactgaccctcttagggtcaatatcatgttccagcacattcagaagatg
ctttcctctgatactgcagtcattgctgagactggggattcctggttcaattgtcaaaag
ctaaagttaccaacaggatgtgggtacgagtttcagatgcagtatggttcaattggatgg
tcagttggtgccactttgggatatgcacaatctgtgcccagcaaaagggtgattgcatgt
ataggcgatggcagctttcaggttacggctcaagatatttcaacaatgatgcggtgcaac
cagaagaccatcatattcttggtcaacaatggaggatacacaattgaggtggaaatccac
gacggcccttacaatgtcatcaagaactggaactacaccgggctagtcgatgccatctgc
aacggggaaggcaaatgctggacaacaaaggtgttcactgaggaggacctgatcaaagca
atagaaacagcaacaggggagaaggcagattgtctgtgtttcattgaagtcatagtccac
aaggatgataccagcaaagagctactcgaatggggttccagagtagcatctgccaatggc
cgcccacccaaccctcagtga

DBGET integrated database retrieval system