KEGG   Ipomoea nil (Japanese morning glory): 109186337Help
Entry
109186337         CDS       T04663                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00260  Glycine, serine and threonine metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109186337
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     109186337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_3 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 109186337
NCBI-ProteinID: XP_019191823
Position
Un
AA seq 359 aa AA seqDB search
MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP
SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ
IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLSAEYTDKVGELAKKYGLKLHIDGARI
FNASAALGVPASRLVQAADSVSVCLSKGLGAPVGSVIVGPKSFIDRARIMRKTLGGGMRQ
IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN
TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaaggactgtggatctccgctctgacacagttactaaaccaacagaagccatg
cgggctgcaatggcaagtgctgaagtagatgatgacgtgttgggttttgacccaacagcc
caacgccttgaagcagaaatcgcaaagatcatgggcaaagaagctggtctttttgttcct
tcaggcacgatgggtaacctgattagcgttcttactcattgtccaattaggggaagtgaa
atcatccttggtgattattcgcatatccacatttatgaaaacggaggtatttccaccatt
ggaggtgttcatccgaggacaatcaagaacaacgatgatggaaccatggatcttgatcag
attgaagctgcaatccgagatcctagatttgagatatgtttcccaaccactagactcatc
tgcttggaaaattcaaatgcacactctggtggtagatgcctctcagcagagtatacagac
aaagttggagagctcgcaaagaagtacgggctgaaacttcatattgatggagctcgcata
ttcaatgcatctgctgcccttggcgttcctgctagtaggcttgtacaggctgccgattct
gtttctgtttgtctgtcaaaaggtctgggcgctccagtaggaagtgtaattgttggtccg
aaaagcttcattgacagggcaaggattatgagaaagaccttaggcggtggaatgagacag
ataggcgtgttgtgtgctgctgctcttgttgggtttcaagaaaatgtcggtaagctcgaa
ggggatcacaaaaaggctaaaactttagcagaggggcttaacaaaattagcggactggaa
gttgatatggcttcagtagaaacaaacattgtattctgcgatatacttaaggaagcaaac
acaactgaaatggagctgtgcaagaggctagcggaacatggtgtgctcattctaccagaa
ggcccaaagagaatcaggttcgtgattcaccaccagatttccgacactgatgtgcagtat
gcattatcccgagttcagcgtgctgtgactggagtggcaaatggaagcggggaccattga

DBGET integrated database retrieval system