KEGG   Ipomoea nil (Japanese morning glory): 109186437Help
Entry
109186437         CDS       T04663                                 

Definition
(RefSeq) probable receptor-like protein kinase At5g59700
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ini01001]
    109186437
Enzymes [BR:ini01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109186437
Protein kinases [BR:ini01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109186437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin APH Romo1 ABC1
Motif
Other DBs
NCBI-GeneID: 109186437
NCBI-ProteinID: XP_019191962
Position
Un
AA seq 823 aa AA seqDB search
MCVGAVDLIFLIWSILCLICVSKEYVPVDNYLVNCGSSENVTVSGRVFLADTLNSGILST
PHRIFAKTSSNLNVPFPFNYDSPLYQTARILNGTSEFSFPIRRPGRHWVRLHFFPFMDQN
YNLSSARFSVSAQNSQNFTLLKNFQPSNASVLKEYSFNISTNRLVLVFTPAANSFGFVNA
LEVFSLPDEVIPTGAGMNNPEGSRQDLSGHALETVARVNMGIAAVPPQNDTLWRVWVPDA
GYLRSSKNVVQFVSKKGGVNYTGAGVTQNIAPLLVYETAERLEQVDFSIRFNATWSFAVD
PGFEYFVRFHFCDIVSNSSSRLMFNVFLNSGIVSANLELRTKTSNATDVPYYIDVVKRLG
GDRDLSITIGPSDVGNVLPDGILNGLEIMKISNSKDSLDAADSEIQSSSSSSKAKLWAIL
GSSIGAFCLLVFGLVSVLVYRSRRRGFIDRSTGGDEVSKYAEEASSISRSKVWYRIPFKA
VQEATDNFSEEMIVGIGGFGTVYKGILRDGTRVAVKRGNHQSNQGFSEFMTEIEMLSKFR
HRHLVSLIGYCDEMNEMIIIYEYMENGTLKNHLYGSDLPKLNWRQRLEICIGSARGLHYL
HTGSEKAIIHRDVKSANILLDENLMAKVADFGLSKDGPEFDQTHVTTAVKGSFGYLDPEY
LTRQQLTEKSDVYSFGVVMLEILCGKPVIDPSRPRENVNLIEWVMNALKRGDLETAVDPH
IKAGLNPESLQRFAETAEKCLAGCGLDRPTMGDVLWNLEFALQLQRKEETTSQTHDLAPS
QPEISTSTTQFSIGSMGDLAGVSISRVFSQMVKADMKDLNDKI
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgttggggcagttgatttgatattcttgatttggtccatcttgtgtttgatatgc
gtctccaaagaatatgtccctgtggataactatctggtgaactgtggatcatctgaaaat
gtaactgtgagtggcagggttttcttggctgacaccttgaattctggcattctttcaacc
ccacataggatttttgccaaaacaagttcaaatcttaatgttccattcccattcaactat
gattcacccttgtatcagactgctagaatcctcaatggaacctcagagttcagtttccct
atcaggagacctggcaggcactgggttcgcctgcatttctttccgtttatggaccaaaat
tacaacctgagctctgctagattttctgtttcagcccagaattcccagaattttactctt
ttgaaaaatttccagccgtcgaatgcctcagttcttaaggaatactccttcaacataagt
accaaccggctggtcctcgtctttacccctgctgccaattcatttggcttcgtgaatgct
ttggaagtgttttcgcttcctgatgaggtcatacctactggcgctggaatgaacaatccc
gaaggaagtaggcaggatctgagtggacatgccttggagacggtagcgagagtgaatatg
gggattgcagcagtgccccctcaaaacgataccctgtggagggtttgggtgcctgatgcc
gggtatctcagaagcagtaagaacgtcgttcaatttgtgtcgaagaaaggaggggtgaac
tacacgggagcaggggtgacacagaacattgctcccctgcttgtctatgaaaccgcggag
aggctggagcaggtggatttcagcatccggtttaatgcaacctggtcgtttgcagtggat
ccaggctttgagtatttcgttcggttccacttctgtgatatcgtaagtaactcctctagt
aggctcatgttcaatgttttcctcaattcgggtatcgtttctgcaaaccttgaactgaga
actaaaacttcaaatgccacggatgttccctattacatcgatgttgtcaaaaggttgggc
ggtgatcgtgatcttagcataacgattggcccatcggacgtgggcaatgtgcttcctgat
ggcatcctgaatgggctggagatcatgaaaataagcaattctaaggacagtcttgatgca
gcagactccgaaattcagtcctcgagttctagttccaaggctaaactatgggcgattctt
ggatcaagcattggagcattctgtttgttggttttcggtttggtttccgttcttgtttac
cgaagtagaagaagggggttcattgaccgctcaaccggaggtgatgaagtgagtaaatat
gcagaagaagcatcttccatctcgaggtcaaaggtgtggtatcgcatccctttcaaggca
gttcaagaagctacggataatttcagcgaagaaatgatcgttggaattggcggttttggg
acggtttacaagggaattctgagagatggcacgagagtcgctgtaaagagagggaatcat
caatcgaaccaaggcttttccgaattcatgacagaaatagagatgctgtctaagtttagg
catcgccatctggtatcgttgattgggtactgcgatgaaatgaacgagatgatcataata
tacgagtacatggagaatggaactctgaagaatcatttgtatggctcagatcttcccaag
ttgaactggagacagcggcttgaaatctgcattggatctgcgaggggacttcactatctg
cacaccggctctgagaaggcgattatccatcgagatgtgaagtcagcaaatatattacta
gacgagaatctcatggctaaggttgcagattttggactgtcaaaagatggccctgagttt
gatcagacacatgtcaccactgcagtgaaaggaagtttcggttatcttgatcccgagtac
ctgacaagacaacaactgaccgagaagtcagatgtttactcgtttggagttgtcatgctc
gaaatcctctgtggaaagcctgtcatcgacccatctcgtccccgagaaaacgtgaacttg
atcgagtgggtgatgaacgcgctaaagagaggcgacttggaaacagccgtggatcctcac
atcaaggcaggactaaacccggagtctcttcaaaggtttgcagagacagcagagaaatgc
ttggctggatgtgggctcgatcgacccacaatgggagacgttctgtggaacttggagttc
gctctccagctccaacggaaagaagagacgaccagtcagacccacgacctcgcccccagc
cagcccgagatcagcacctccaccacgcaattcagcattggaagcatgggggaccttgct
ggtgtttccataagtagagtgttctcccaaatggtaaaagctgatatgaaagacttgaat
gacaagatatag

DBGET integrated database retrieval system