KEGG   Ipomoea nil (Japanese morning glory): 109186906Help
Entry
109186906         CDS       T04663                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00052  Galactose metabolism
ini00500  Starch and sucrose metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109186906
   00500 Starch and sucrose metabolism
    109186906
Enzymes [BR:ini01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109186906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 109186906
NCBI-ProteinID: XP_019192639
Position
Un
AA seq 666 aa AA seqDB search
MASSHLNPTYDLENAAAAAYTPLPEQPHSAGVQTRDRKPFKVISGIILSSLFLLALILVA
VNYQAPPSQAPPLSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRV
SFAWSNLMLSWQRTGYHFQPVKNWMNDPNGPLYYKGWYHLFYQYNPDSAVWGNITWGHAV
STDLIHWLHLPFAMVPDQWYDVNGVWTGSATILPDGRIVMLYTGDTDDYVQVQNLAYPAN
LSDPLLVDWVKYPNNPVLFPPPGIGVRDFRDPTTAWTSGSQNGQWLVTIGSKVGKTGISL
VYETTNFTSFKLLDGVLHAVPGTGMWECVDLYPVSTTGEYGLDTSANGLGIKHVLKASLD
DDKHDYYALGTYDPVKNKWTPDNPDLDVGIGLRLDYGKYYASKTFYDQNKQRRILWGWIG
ETDLESVDLMKGWASLQAIPRTIVFDKKTGTNVLQWPVEEVESLRSGDPITAKANLEPGS
VVPIHVSEGTQLDITASFEVDETLLETTSESHDAGYECSNSGGAVTRGSLGPFGLLVVAD
EKLSELTPVYFYIAKGADGKTNTHFCADQTRSSMASGVEKEVYGSAVPVLDGENYSARVL
IDHSIVESFAQGGRTVITSRIYPTKAIFGAAKVFLFNNATKATVTASVKMWQMNSADIKR
FPLDEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctagctctcatttgaaccccacttacgatcttgaaaatgcggccgcggccgcgtac
actcccctgccggagcaaccccattccgccggagttcagacccgtgaccggaaacccttc
aaggtcatctccggcattatcctctcctcacttttcctgctcgctttaatcctcgtggcg
gtaaattaccaagcgccaccatctcaggcgccgccgcttagcagcggcggcgacaattct
caacatcctgccccgtccgaatccgcgcagccggcggctgtaatcccgccgtccagaggg
gtgtctcagggtgtttccgagaaggcgttccggggagcctccggcgccggcaaccgagtc
tcgtttgcttggagtaatctcatgttgagttggcaacgaacgggttaccattttcaacct
gtgaagaattggatgaatgatcctaatggcccattatactacaaaggatggtaccacctt
ttctatcagtacaatccagattccgctgtttgggggaatattacgtggggccacgctgta
tcaacggacctgattcattggctccacctaccattcgccatggttccagatcaatggtac
gacgttaatggtgtctggactggatccgccaccattcttcccgacggtcggatcgtcatg
ctctacaccggcgacaccgatgactatgttcaggtccagaatcttgcttatccggccaac
ttgtcggatcctctgctcgttgactgggtcaaatatccgaataatccggtgttattcccg
ccgccagggataggtgtcagggactttagggaccctaccactgcatggacatctggcagt
caaaacggtcaatggttggttacaatagggtccaaggtcggtaaaaccggtatttcactt
gtttatgaaaccaccaatttcaccagctttaagctcttggatggagtgttgcatgcggtt
ccgggtacgggtatgtgggaatgcgtggacttgtacccggtttcgaccaccggagaatac
gggcttgacacgtcagctaacgggttaggtatcaagcacgtattaaaagctagtctggat
gacgataaacacgattactatgcacttggaacatatgacccggtgaaaaacaagtggaca
cccgataacccggatttggatgtgggtatcgggttgagacttgattatgggaagtactat
gcatccaagacgttttatgatcagaacaagcagagaagaatcttgtggggatggattggt
gaaactgatttagaatctgttgatctcatgaaaggctgggcatctcttcaggcgattcct
aggaccatagttttcgacaagaagactgggacaaacgtgcttcaatggccggttgaagaa
gtggaaagcttgagatcaggagatcctataactgctaaggcgaatcttgaaccgggatct
gtggtgccaatccatgtttcagaggggacacagttagacataactgcttcatttgaagtg
gatgaaacccttcttgaaacaacctcggagtcccatgacgctggctacgagtgcagtaat
agcggcggcgccgttacacgcggcagtttgggaccgttcgggcttctggttgtcgccgat
gaaaaactttctgagttgacgcctgtctacttctacattgctaaaggcgccgacgggaag
acaaacactcatttctgcgccgaccagaccagatcatccatggcttctggagttgaaaag
gaagtatatggtagcgcagtgccggttcttgatggtgaaaactactctgctagagtactg
attgatcattcgatagtagagagctttgctcaaggaggaagaacggtgatcacatcaaga
atttatccaacaaaagccatttttggagctgcaaaagttttccttttcaacaatgctact
aaagctactgtcacagcatcggtgaagatgtggcaaatgaattcagcggatattaaacga
ttccccttggatgagttgtag

DBGET integrated database retrieval system