KEGG   Ipomoea nil (Japanese morning glory): 109187863Help
Entry
109187863         CDS       T04663                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00350  Tyrosine metabolism
ini00360  Phenylalanine metabolism
ini00380  Tryptophan metabolism
ini00950  Isoquinoline alkaloid biosynthesis
ini00965  Betalain biosynthesis
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109187863
   00360 Phenylalanine metabolism
    109187863
   00380 Tryptophan metabolism
    109187863
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109187863
   00950 Isoquinoline alkaloid biosynthesis
    109187863
   00965 Betalain biosynthesis
    109187863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ini04147]
    109187863
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109187863
    4.1.1.105  L-tryptophan decarboxylase
     109187863
Exosome [BR:ini04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109187863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 109187863
NCBI-ProteinID: XP_019193773
Position
Un
AA seq 508 aa AA seqDB search
MGSLDEKNVPQSTSNIISEFKPLDVEEFRRQAHRMVDFIADYYNNIESYPVLSQVEPGYL
RNRQPPTAPNRPEEFETILSDIHKDILPGMTHWLSPNFFAFFPATVSSAAFVGEMLCTCF
NSVGFNWLASPAATELEMVVMDWLANMLKLPKSFMFAGSGGGVIQGTTSEAILCTLIAAR
DRALRIIGCHNVGKLVVYGSDQTHSTYAKACKLAGIFPCNIRIIPTSHDTNFSLSPVALR
GVIESDVAAGLVPLFLCATVGTTSTNAVDPVSRLADVAVDHNIWVHVDAAYGGSACICPE
FRHHLDGIERVDSLSLSPHKWLLTYLDCCCLWVREPGSLVKALSTNPEYLRNKRTGHDTV
VDYKDWQLGTGRRFRSLRLWLVLRSYGVANLQTHIRSDVRLAKMFEGLVGSDPRFEIAAP
RVFSLVCFRLNPYKGSERRFTEVLNMKLLESVNSTGRAYMSHTIAGGVYMLRFAVGATLT
EDHHVAAAWKLVQDSADALLISTRNNFV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtcttgatgaaaagaatgtcccacaatccacatccaacattatcagtgaattc
aagccgcttgatgttgaagagtttcgtaggcaagctcatcgtatggtcgactttattgcc
gactattataataatattgagagttaccctgttctgagccaggtggagcctggctatctc
cggaatcgtcagccgccgacggctccgaatcggccggaagagtttgagaccattttgagc
gatatccacaaggatatacttcccggcatgactcattggttaagcccgaatttctttgcg
tttttcccggccaccgtaagctctgcagctttcgtcggagaaatgctgtgcacctgcttc
aactccgtcggcttcaactggctcgcatctccggcggccaccgagttagagatggtggtc
atggactggctggcaaatatgctcaagcttccaaaatccttcatgttcgccggatctggc
ggcggcgttatccaaggaaccaccagcgaggcaatcctctgcaccctcatcgccgcccgt
gatcgtgcgttaaggatcataggctgtcataacgtcggaaagctcgtcgtttatggctcc
gatcagactcactcgacgtacgcaaaagcttgcaagttggccggaattttcccatgcaat
attaggataattccaacctcacacgataccaacttctctttatctccggtggccctacgc
ggagtaattgaatctgacgtggcagcggggctggtcccactcttcctctgtgcaactgta
gggaccacttccacgaacgctgttgaccctgtcagccgtcttgcggacgtggccgtggat
cacaacatttgggtccacgtggacgccgcgtacggcgggagcgcgtgcatatgccccgag
ttccggcaccacctggacggaattgaacgagttgactcgctgagtctgagtccgcacaag
tggctactcacttacctggactgctgttgcctgtgggtcagggaaccgggttcgctcgtc
aaggctttgagtaccaacccggagtacttgcgaaacaaacggaccggccacgataccgtg
gtggactacaaggactggcaactcggaaccggccgccggttcagatcgctccggttatgg
ctcgtcctgcgcagttacggcgtcgccaacctccaaacccacatccgctccgacgtccgg
ctggccaagatgttcgaagggttggtcggatccgacccgaggttcgagattgcggcgccc
cgggtgttttcgttagtttgctttcggttaaacccgtataagggatcggaacggcgtttt
acggaggtgttgaatatgaagctactggagtctgtgaactcaacgggtcgggcgtatatg
agtcacaccatagccggcggggtgtatatgctgaggtttgcagtgggggccacgctgacg
gaagaccaccacgtggccgccgcttggaagttggtacaagactcagctgatgctctgcta
atcagtacaaggaataacttcgtttag

DBGET integrated database retrieval system