KEGG   Ipomoea nil (Japanese morning glory): 109187908Help
Entry
109187908         CDS       T04663                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00730  Thiamine metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    109187908
Enzymes [BR:ini01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     109187908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 GMC_oxred_N HI0933_like Lycopene_cycl FAD_oxidored GIDA Pyr_redox_3 NAD_binding_9 FAD_binding_3 RNA_pol_Rpb1_3 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 109187908
NCBI-ProteinID: XP_019193858
Position
Un
AA seq 368 aa AA seqDB search
MATMASTLAASSSVSKTSFLDAHKSFFHGTPAVSSQPARSFTQPLKSPISRNMAISMSAS
SASASTPPPYDLKSFTFEPIKESIVSREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE
LSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVEYDEQDNYVVIKH
AALFTSTIMSKLLSRPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNV
MEAKVVVSSCGHDGPFGATGVKRLKSIGMIESVPGMKALDMNTAEDAIVRLTREIVPGMI
VTGMEVAEIDGAPRMGPTFGAMMVSGQKAAHLALKSLGMANAIDGDEVGSIHPQLIMAAA
DDSEVVDA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatggcttctaccttggccgcttcttcctcagtatccaaaacctctttcttg
gatgctcataaatccttcttccatggaacccctgccgtctcttcacaacctgcaaggtct
tttacacaaccccttaaatcccccatttccagaaacatggctatctctatgtccgcttct
tctgcttctgcttccactcctcctccttacgatctcaaaagcttcacgttcgaacccatc
aaggagtccattgtttctcgggagatgaccaggcggtacatgacggacatgatcacctac
gccgataccgatgtcattgttgttggcgctggatctgctggcctctcttgcgcttatgag
ctcagtaagaaccctaacgttcaggtggcgataatagagcaatcggtgagccctggcggg
ggggcatggctgggcgggcagctgttttccgccatggtggttcgcaagccggctcatctg
ttcctggacgagctgggcgtggagtacgacgagcaagacaactacgtggtgataaagcac
gcggcgctcttcacgtcgaccatcatgagcaagcttctaagcaggccgaacgtgaagctg
ttcaacgcggtggcggcggaggacttgatagtgaagggcgggagagtgggcggcgtggtc
accaactgggctctggtgtccatgaaccacgacacgcagtcgtgcatggaccccaacgtg
atggaggccaaagtggtggtcagctcctgcggccacgacggccccttcggggccaccgga
gtcaagaggcttaagagcatcggcatgattgaaagtgtccccgggatgaaagctttggat
atgaacacggcggaggacgcaatcgtaaggctgactagagaaatcgtgccggggatgatt
gtcaccggcatggaggtcgctgaaatcgatggagcaccaagaatgggaccgacgtttgga
gcgatgatggtatcagggcagaaggcggcgcatttggcactgaaatctctaggaatggct
aatgctattgatggtgatgaggttggaagcattcacccacagctcataatggctgcggct
gatgattcagaggtagtggatgcttaa

DBGET integrated database retrieval system