KEGG   Ipomoea nil (Japanese morning glory): 109193109Help
Entry
109193109         CDS       T04663                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ini04131]
    109193109
Membrane trafficking [BR:ini04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    109193109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 109193109
NCBI-ProteinID: XP_019199475
Position
Un
AA seq 960 aa AA seqDB search
MYSKSENGVDGDDEREEEESEEDEEEEEEDEPRLKYQRMGGSVPSLLSNDAASCIAVAER
MIALGTHGGSVHILDFLGNQVKEFHVHTAAVNDLCFDVEGEYIGSCSDDGSVVINGLFTE
ERMKFEYHRPMKAIALDPGYANKSSRRFVTGGLAGQLYFNVKKWIGYRDQVLHSGEGPIH
AVKWRASLVAWANDAGVKVYDAANDQRITFIERPRGSPHPEHLLPHLVWQDDTLLVIGWG
TSVKIAVIRTNQNKGVNGTYKHIPMSSLNQVDIVASFQTSYFISGIAPFGDTLVILAYIT
GEEKEKDFSSTVPSRQGNAQRPEVRVVTWTNDELATDALPVHGFEHYKAKDYSLAHAPFS
GSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRLVIVSSHLIYWDAEDHINWLLQHGCHEKA
LEAVEASKGRSELVDEVGSRYLDHLIVERQYAEAASLCPKLLRGSASAWERWVFHFAHLR
QLPVLVPYIPIENPRLRDTAYEVALVALATNPSFHKDLLATVKSWPPGIYSTSPVISAIE
PQLSTSSMTGPLKEALAELYVIDGHHDKAFSLYADLMKPDLFDFIEKHNLHDAVSEKVAQ
LMMIDCKRAIPLLLQHRDLIPPPEVVSQLMAAGNEGDSRYLMHLYLHALFETNPHAGRDY
HDLQVELYAEYDPKMLLPFLRSSQHYTLEKAYDICVKRNLLKEQVFILGRMGNSKQALAV
IINKLGDIEEAIEFVNDQHDDELWDELIRQCLNKAEMVGVLLEHTVGNLDPLYIVNMLPN
GLEIPRLRDRLVKIITDYRTETSLRHGCNDILKADCVNLLIKYYKEAKRGIHLSDEVDEA
RSKRGEQRASNLVDRTLSIKSMEVKSKTRGGGRCCICFDPFSIQSISIIAFFCCHAYHLT
CLMESTNSVSSKKEAAAPSQGASSYYEYDNGEVDEDEDEDEATSSGAPRMRCILCTTAAG
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgaagtcggaaaacggagtcgacggtgacgacgagagggaagaagaagagtcc
gaagaggacgaggaggaagaagaagaggatgagccgagactcaagtatcagagaatgggc
ggcagtgtgccgtcgctcctctccaacgacgccgcctcctgcatcgccgttgctgaacgg
atgatcgccctcggcactcacggtggctcggttcacattcttgatttcctaggcaatcag
gtaaaggaatttcatgttcacactgctgcagtgaatgacctttgctttgatgtggaaggt
gaatacattgggagctgttcagatgatgggtcagttgtaattaatggtctttttactgaa
gaaagaatgaaatttgagtatcaccgccccatgaaggctattgctctagacccaggttat
gctaacaaatcatccagaagatttgtcactggtggtttagctggtcaattgtattttaat
gtcaagaagtggataggctaccgtgatcaggttctgcattctggtgaaggtccaattcat
gctgtgaagtggagagctagtctcgttgcatgggctaatgatgcaggagtgaaagtttat
gatgctgccaatgaccagcgcataacttttattgaaagacctcgtggaagtccacaccct
gagcatctgctacctcacttagtttggcaggatgatacgcttttggtgattgggtgggga
acttctgtgaaaattgcagtaataagaacaaatcagaacaagggtgtgaatggcacatac
aaacatatcccaatgtccagcctgaaccaggtggatattgtggcatcttttcaaaccagc
tatttcatttcaggaattgctccatttggtgatactttggttattcttgcttatattacg
ggagaagagaaagagaaggatttcagtagtaccgttccctcacgtcagggaaatgctcag
agaccagaggtccgagttgtaacatggactaatgatgagcttgcaactgatgcacttcct
gtccatggttttgagcattataaagccaaagactattcccttgcacatgctccattctct
ggtagcagctatgcaggtggacagtgggctgctggtgatgaacctttgtactatattgtg
tccccaaaggatgtagttattgcaaagcctaggttagtgatagttagttcccatttgatt
tattgggatgcagaagaccacattaattggcttcttcagcatggatgtcatgagaaagcc
ttagaagctgttgaagctagtaaaggtcggagtgagctagttgatgaggtaggttcaagg
tatcttgaccatctgattgtggaaaggcagtatgctgaagctgcatctctgtgtccaaaa
ctgttgagaggatctgcctctgcatgggaaagatgggttttccattttgcccatcttcgt
cagcttcctgtattggttccttatatcccaatagaaaatccaaggttgcgtgatactgct
tatgaggtagctcttgtggcattggcaacaaacccctctttccacaaggatctcttagca
actgtcaaatcttggcctcctggcatttattctacatccccagttatatcagctatagaa
cctcagcttagcacatcatcaatgactggtccactcaaggaggcactggcagaattatat
gttattgatggacatcatgataaggccttttcactgtatgctgatcttatgaagcctgat
ctatttgacttcattgaaaagcataatttgcatgatgctgtttctgaaaaggttgcccaa
cttatgatgatagactgtaagcgcgcaataccgttgttgcttcaacacagagacttaata
ccgcctccagaagttgtgtcacaactcatggccgcaggaaatgagggtgattctcgatac
ttgatgcatctgtatcttcatgcactctttgaaactaatcctcatgctgggagggattac
catgatctccaggtcgaactttatgctgagtatgatccaaagatgctgcttccttttctt
aggagtagccagcattatacacttgagaaggcgtatgatatctgtgtcaaaagaaatcta
ttgaaagaacaagttttcatactaggaaggatggggaattctaagcaagcccttgcagtt
atcataaataagctaggagatattgaagaggctatagaatttgtgaatgatcagcatgat
gatgaactatgggatgaattgattaggcagtgtcttaataaagctgaaatggttggagta
ctattagagcacactgtggggaaccttgatcctctttatatagtaaatatgctgcccaat
ggcttggagatacctcgtttgagggatcgcttggtcaaaattatcacagactacaggaca
gaaacttcgcttaggcacggttgtaatgatatactcaaggctgattgtgttaaccttttg
attaaatactacaaagaagcaaagcgtggtattcacttgagtgatgaagtagacgaagct
cgctccaaaaggggtgaacagagggcttcaaatctggttgaccgaactcttagcataaaa
tccatggaggtcaaatcaaaaactaggggaggtggaaggtgttgcatatgctttgatcca
ttctccatacagagtatatcgatcattgcattcttttgttgtcatgcctatcacttgact
tgccttatggagtccaccaactctgtgagtagcaaaaaagaggcagccgccccttcccaa
ggtgcttcctcatattatgaatatgataatggtgaggtagatgaggatgaggatgaggat
gaagctacctcatctggtgcccctcggatgcgttgtatcttgtgcactactgctgcaggt
tga

DBGET integrated database retrieval system