KEGG   Iodobacter sp. H11R3: EJO50_00075Help
Entry
EJO50_00075       CDS       T05767                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
iod  Iodobacter sp. H11R3
Pathway
iod00450  Selenocompound metabolism
iod00970  Aminoacyl-tRNA biosynthesis
iod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iod00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EJO50_00075
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EJO50_00075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:iod01007]
    EJO50_00075
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:iod03016]
    EJO50_00075
Enzymes [BR:iod01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EJO50_00075
Amino acid related enzymes [BR:iod01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EJO50_00075
Transfer RNA biogenesis [BR:iod03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EJO50_00075
 Prokaryotic type
   Other AARSs
    EJO50_00075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZN35025
UniProt: A0A3S8ZNF6
Position
complement(14232..16304)
Genome map
AA seq 690 aa AA seqDB search
MPRKILVTSALPYANGAIHLGHMVEHIQTDIWVRFQKQRGHICHSVCADDTHGAPIMLRA
EKLGITPESLIAQSQRDHMRDFAGFHVSYDNYYSTNSPENKQFAGEIYKKLKADGKIANR
SISQLYDPQKNMFLADRFVKGECPKCAAKDQYGDNCEVCSATYSPTELKNAYSAISGATP
ELRESEHYFFKLGDCEEFLKVWTKESTLVDGKQRPRLQAEASNKMQEWFEAGLSDWDISR
DAPYFGFEIPDAPGKYFYVWLDAPVGYMASHKNLCDRLGLDFDSYWKKDSDAELYHFIGK
DILYFHALFWPAMLEYAGYRTPTAINAHGFLTVDGAKMSKSRGTFITAESYLKHLNPEWL
RYYFAAKLGSGVDDLDLNLEDFSARVNSDLIGKYVNIASRAAGFISKRFEGRLHDGIFTA
SDYPLMDRIIALQRQLQGAGDKLAALFEAREYGRAIREIMALTDEVNQYVDSMKPWAMAK
DPEQSLHLHVVCSFLINAFRILTIYLKPVLPKLAADVEQFLNVAPFTWNDAQVLLLDHTI
ETYQHLMTRIDPKDIAAMVEENKQNLEATTPVAKPDYEIPPITETISIDDFMKIDLRVAM
ITEAKAVEGADKLVSLTLDIGNETRHVFAGIKAAYKPEELQGRMTVMVANLAPRKMKFGV
SEGMVLAAGGDGGLYILSPDTGAKPGMRVK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaagattctcgttacctcagcccttccctacgccaacggtgcgattcacctt
ggccacatggtcgaacatattcagactgatatctgggtacgctttcaaaaacaacgtggc
catatctgccacagcgtatgtgccgacgacacgcacggcgcgccgattatgctacgtgca
gaaaaactggggatcacacctgaatccttgatcgcccaatcgcaacgcgatcatatgcgt
gattttgcaggctttcatgtgtcctatgacaattactacagcaccaacagcccggaaaac
aagcagtttgctggcgaaatctacaaaaaactgaaagccgatggcaagattgctaatcgc
agcatcagccagctttatgacccgcaaaaaaacatgtttctggctgatcgctttgttaaa
ggtgaatgccctaagtgcgccgctaaagatcaatatggcgataactgtgaagtctgcagc
gcgacctattccccgaccgagttaaaaaatgcttactcggctatttccggtgccacacca
gagctgcgtgaatccgagcactacttctttaagctgggtgattgtgaagaatttctgaaa
gtttggaccaaagaatccaccctcgtagatggtaaacagcgcccgcgcttacaagccgaa
gcctccaacaagatgcaagaatggtttgaagccggtctttccgactgggatatcagccgc
gatgcgccttattttggttttgagattccggatgcacccggcaaatatttctatgtctgg
ctggatgcaccggttggctacatggccagccacaagaacctgtgcgaccgtctgggctta
gattttgacagctactggaaaaaagattccgatgccgagctgtatcactttatcggcaaa
gatattctgtatttccacgcgctgttctggcccgccatgctggaatatgcaggctaccgc
accccgactgccattaatgcccacggctttttgaccgtagatggcgcaaaaatgagcaaa
tcgcgcggcacctttattaccgctgaatcctatcttaagcatctgaatccggaatggctg
cgttattactttgcagcaaaattaggcagcggcgtggatgatctggatttaaatctggaa
gacttcagcgcccgggttaattccgatctgatcggtaaatacgttaatatcgccagccgc
gcagcaggctttatcagtaaacgctttgaaggccgcttgcatgatggcattttcaccgcc
agcgattacccgctaatggatcgtatcattgcgctgcaacgccagttacaaggcgctggc
gataaactggctgcactgtttgaagcacgtgaatatggccgagcgattcgtgaaattatg
gcgctgaccgatgaagtcaatcagtatgtagacagcatgaagccttgggcgatggcaaaa
gatcctgaacaaagcttgcatctgcatgtggtttgcagcttcttgatcaatgctttccgt
attttaacgatctacctcaaaccggtgctgcctaagctggctgcagatgtagagcagttt
ctgaatgttgccccgtttacctggaacgatgcgcaggtcttgctgcttgatcacactatc
gaaacctatcagcatttaatgacgcgaatcgatccaaaagatatcgccgccatggtagaa
gaaaacaagcagaacctggaagccaccactcctgtagccaagccggattatgaaatcccg
ccgattacggaaaccatcagcattgatgatttcatgaaaatcgatttacgcgtagccatg
attaccgaagcaaaagcagtagaaggcgcggataaactggtgtctttaacgctggatatc
ggcaatgaaacccgccatgtatttgccggtattaaggccgcatataagcctgaagagctg
cagggccgcatgaccgtgatggtggccaatcttgcaccacgcaaaatgaagtttggtgta
tcagaaggcatggtactggctgccggtggtgatgggggcctgtatatcctcagcccggat
accggcgccaagcccggcatgcgcgtgaagtaa

DBGET integrated database retrieval system