KEGG   Iodobacter sp. H11R3: EJO50_03800Help
Entry
EJO50_03800       CDS       T05767                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
iod  Iodobacter sp. H11R3
Pathway
iod00220  Arginine biosynthesis
iod01100  Metabolic pathways
iod01110  Biosynthesis of secondary metabolites
iod01130  Biosynthesis of antibiotics
iod01230  Biosynthesis of amino acids
Module
iod_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:iod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EJO50_03800 (argF)
Enzymes [BR:iod01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     EJO50_03800 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AZN38066
UniProt: A0A3S8ZX81
Position
complement(851168..852091)
Genome map
AA seq 307 aa AA seqDB search
MFPMRHYLQFTDFTREEYDYLFKRAAILKAKLAAGELYQPLIGKVLAMIFEKSSTRTRVS
FEAGMAQFGGHAMFLQSKDTQLGRGEPIEDVAKVISRMTNIVMVRTFEQSIVERFADNSL
VPVINGLTNEYHPCQILADIFTYIEKNGSIEGKTVAWIGDSNNISRTWLQAAKIFNFKLK
QACPRGYEMTVLDGQKYDVEHFETFYDPYQAARDADIVTTDVCTSMGFERETLQRRKDFL
HYRVSEKVMLQAKANAMFMHCLPAHRGEEVDPEVIDGPQSVVWDEAENRMHTQKAVIEYL
LLGKVEE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ctgttccctatgcgccattatctgcagtttactgattttacccgcgaagaatatgactat
ctgttcaaacgcgctgccattcttaaagccaaactggccgcaggcgagctttaccagccg
ctgattggtaaagtgctagccatgatttttgaaaaatcatccacccgtactcgtgtttct
tttgaagcaggcatggcgcagttcggtggtcatgcgatgtttttgcaatccaaagacacc
cagttgggccgtggcgagcctatcgaagatgtggcgaaagtcatcagccgcatgaccaat
atcgtaatggtacgtactttcgagcaaagtattgttgaacgctttgccgataattcttta
gttcccgttattaacgggctgaccaatgaatatcacccatgccagattctggccgatatt
tttacctatatcgaaaaaaatggctcgatcgaaggcaaaacagtagcctggattggtgat
agcaacaatatttcccgcacctggctacaagctgcaaaaattttcaatttcaaactcaag
caagcctgtccgcgcggctatgaaatgacagtacttgatggccagaaatatgacgttgag
cattttgaaaccttttacgatccgtatcaagccgccagagatgccgacatcgtaactacc
gatgtatgcacttcaatgggatttgagcgtgaaaccttgcaacgccgaaaagactttttg
cattacagagtcagcgaaaaagtcatgctgcaagctaaggccaacgccatgtttatgcac
tgtctgccagcgcatcgtggcgaagaagtcgacccggaagtcatcgacggaccacaatcg
gtcgtctgggatgaagcagaaaatcgcatgcacacacaaaaagctgtgattgaataccta
ttactgggtaaagtagaggaataa

DBGET integrated database retrieval system