KEGG   Iodobacter sp. H11R3: EJO50_06445Help
Entry
EJO50_06445       CDS       T05767                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
iod  Iodobacter sp. H11R3
Pathway
iod00540  Lipopolysaccharide biosynthesis
iod01100  Metabolic pathways
Module
iod_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:iod00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EJO50_06445 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:iod01005]
    EJO50_06445 (rfaD)
Enzymes [BR:iod01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     EJO50_06445 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:iod01005]
 Unusual sugar
  EJO50_06445 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AZN36150
UniProt: A0A3S8ZRM6
Position
1470602..1471597
Genome map
AA seq 331 aa AA seqDB search
MAIVVTGAAGFIGSNIIKGLNARGETEIIAVDDLALPDQFKNLVDCQISHYADKEDFIAD
LSEGHYDGEITAIFHEGACSDTMEHNGKYMMDNNYQYTLALFDWCQAEEVQFLYASSAAT
YGNGDHGFIESPDCEAPLNVYGYSKLLFDQVLRQRMNEITAQVVGFRYFNVYGPREQHKG
RMASVAFHHFNQYREHGKVKLFGEYGGYGNGGHTRDFISVEDVVKANLWFLDNPDVCGIY
NLGTGKSQPFNDVALAVVNTCREHEGKATLSLEEMITQGVLEYIDFPDSLKGKYQCFTEA
DTTLLRESGYDEDFLTVEEGVRRYVEVLLKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgttgttaccggagctgccggttttattggttcaaatattattaaaggcctg
aatgctcgtggcgaaaccgagattattgctgtggatgatttggctttgccggatcaattt
aaaaatctggttgattgccaaattagccattacgcggataaagaagattttattgccgat
ttaagcgaagggcattacgacggcgaaatcactgctattttccatgagggggcttgttca
gatacgatggagcataacggaaagtatatgatggataataactatcaatataccttggct
ctgtttgattggtgccaagccgaagaagtgcagtttttatatgcatccagtgcagctact
tatggcaatggtgatcatggttttattgaaagccctgattgtgaagctccactgaatgta
tatggttattccaagcttttattcgaccaggtgctgcgccagcgtatgaatgaaattact
gcacaggttgtgggctttcgttattttaatgtgtatgggccgcgtgagcagcataaaggc
cgtatggcttcggtggcttttcaccatttcaatcaataccgtgaacacggtaaagtaaaa
ttatttggtgagtatggtggttacggtaatggtggccatacgcgcgattttatttctgta
gaagatgttgttaaagccaacctatggtttctggataatcccgatgtttgcggtatttac
aatttgggtacaggtaaatcgcagccatttaatgacgtagcattggcggtagttaatact
tgtcgtgagcatgaaggtaaagcaacacttagcctggaagaaatgattacacagggtgtg
ctggaatatattgattttccggattcactcaaagggaagtatcaatgttttaccgaggcc
gatactaccttattacgggagtccggctacgatgaagactttttaacggtggaggaggga
gtgcgccgttatgttgaagtgttattgaagaaataa

DBGET integrated database retrieval system