KEGG   Iodobacter sp. H11R3: EJO50_07080Help
Entry
EJO50_07080       CDS       T05767                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
iod  Iodobacter sp. H11R3
Brite
KEGG Orthology (KO) [BR:iod00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EJO50_07080 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: AZN36268
UniProt: A0A3S8ZS18
Position
complement(1617818..1618201)
Genome map
AA seq 127 aa AA seqDB search
MSDSPVYSVLVHAEAFYLPEQSDEVADRYAFAYRITITNTGTAAAQLLSRHWVIRDMEDH
VQEVQGEGVVGEQPVLEPGQHFEYMSSASIATPIGSMQGNYRMQAADGSQFDAEIPSFVL
AMPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattcccctgtatatagcgtgcttgttcacgccgaagctttttatctgccagag
caatcggatgaagttgctgatcgctatgccttcgcctatcgcattaccatcaccaatacc
ggcacggcagcggctcagcttttgagccgccattgggtgattcgggatatggaagatcat
gtgcaggaggttcagggggagggggtagtgggggagcagccagtgttagagcctggtcag
cactttgagtatatgagcagtgccagtatcgcgacacctattggctctatgcaaggaaat
tatcgtatgcaagcggcagatggcagccagtttgatgcagaaattccttcgtttgtcctg
gcaatgccgcgtactttacactga

DBGET integrated database retrieval system