KEGG   Isosphaera pallida: Isop_1633Help
Entry
Isop_1633         CDS       T01407                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ipa  Isosphaera pallida
Pathway
ipa00051  Fructose and mannose metabolism
ipa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Isop_1633
Enzymes [BR:ipa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Isop_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADV62217
UniProt: E8R090
Position
2371135..2372127
Genome map
AA seq 330 aa AA seqDB search
MSDYPAVNEWKTRQFMCEVGRRIYAKGFAAANDGNISFRLSEDRVLCSPTRVSKGFMKPD
DLCIVDLDGVQISGKRKRSSEILLHLTIMKTRPDVRAVVHCHPPHATAFAVAHEPIPKCT
MPEFEVFLGEVAISPYETPGGQSFADTVIPYVKDTDTILLANHGTVTCGTDLEDAYFKTE
IIDAYCRILILARQLGRVQYYPDEKAAELIRLKPNLGIRDVRLELGLENCDLCGNSLFRE
GYSDFKPEPYAFRHPRLGGDATGIGPVAGPHSTNANANVNANASPPIQVQPGSPEFEQMV
QMITDEIMGHLAGRSTSVSASAAASNPGGC
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactatccggcggtcaacgagtggaagacgcggcagttcatgtgcgaggtgggc
cggcggatttacgccaaagggttcgccgcggccaacgacggcaacatctcgttccgtttg
agcgaggatcgggtgctgtgttcgcccactcgggtttccaaagggttcatgaagccagac
gacctgtgcatcgtcgatctggacggcgttcagatttcgggcaagcgcaagcgttccagc
gagattctgctgcacttgacgatcatgaaaacccgtcccgacgttcgcgcggtggtccac
tgccacccgccccacgcgaccgccttcgccgtcgcccacgaaccaatccccaaatgcacc
atgccggagttcgaggtcttcctgggcgaagtggcgatcagcccctacgagacccccggc
ggccagagcttcgcggatacggtcatcccctacgtgaaggacaccgacacgatcctcttg
gccaaccacggcaccgtcacctgtgggactgacctggaggacgcctacttcaaaacggaa
atcattgacgcctattgccgtattctgatcctggccagacaactgggacgagtgcaatac
tacccagacgagaaagccgccgaactgatccggctcaagcccaacctgggcatccgcgac
gtgcggttggaactgggtctggaaaactgcgacctgtgcggcaacagcctgttccgcgag
ggttactctgacttcaaacccgaaccctacgccttccgccatccccgactcggcggcgac
gccaccggtattggacctgtcgcaggaccccactccaccaacgcgaacgctaacgtcaac
gccaacgcctcccccccaatccaggtccaacccgggtctcccgaatttgaacagatggtg
caaatgatcaccgacgaaatcatgggacatttagccggccggtccacgtcggtctcagcg
tcggccgcagcgtccaatccgggaggatgttga

DBGET integrated database retrieval system