KEGG   Isosphaera pallida: Isop_2023Help
Entry
Isop_2023         CDS       T01407                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ipa  Isosphaera pallida
Pathway
ipa00860  Porphyrin and chlorophyll metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
Module
ipa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Isop_2023
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Isop_2023
Exosome [BR:ipa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Isop_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADV62603
UniProt: E8R384
Position
2953354..2954352
Genome map
AA seq 332 aa AA seqDB search
MMFPGHFPDVRLRRSRRWDWSRRLVREHILTPSDLILPLFVREGSGDPEPVPSMPEVVRH
TIAGVVETARQARDLGIPLVAIFPATDPSLKTPEADEALNPDNLVCRTLRALKAELPNLG
LMADVALDPYSSHGHDGLVRDGDVANDETVQVLARQAVLQARAGADVIAPSDMMDGRVGA
IRKALDAEGFERVIILSYAAKYASAFYGPFRDAVGSKGSLGGASKATYQMDPANGDEALR
EVALDLGEGADWVMVKPGMPCLDIVRRVKETFAAPTFAYQVSGEYAMLHAAAGHGWLDLD
AVVLESLTAFKRAGADGVLTYFALRVARLLNR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatgttccctggtcactttcccgacgtccgcctgaggcggagccgacgctgggactgg
tcccgccgtttggtgcgtgaacacatcctaacgccctccgacttaattctgccgctgttc
gtgcgcgagggctcaggcgaccccgagccggtcccctcgatgcccgaggtggttcgccat
acgatcgccggagtcgttgaaaccgcccgccaggcccgcgatctgggcatcccattggtg
gcaatctttcccgccaccgaccccagcctcaagactcccgaggccgatgaagccctcaac
cccgacaacctggtgtgccgaaccctgcgtgccctcaaggccgaactgcccaacctagga
ctgatggccgacgtggcgctcgatccctactccagtcacggccacgacggcctagtgcgc
gacggcgacgtggccaacgatgaaaccgttcaggtgctggcgcgtcaagcggtcctgcaa
gcccgcgcaggggccgatgtcatcgccccctccgacatgatggatgggcgggtcggcgcg
atccgcaaggcactcgatgccgaagggtttgaacgagtgatcattttgtcgtatgcagcg
aagtacgcttcggcgttttatgggccgttccgcgacgcggtgggttccaaggggtcgctg
ggcggcgcaagcaaggcgacctatcagatggaccccgccaacggcgacgaggcgctccgc
gaagtggcgcttgatctgggcgaaggggccgattgggtgatggtgaagccgggaatgcca
tgtttggacattgtgcgacgggtcaaggagaccttcgccgcgcccaccttcgcctaccag
gtcagcggcgaatacgccatgcttcacgccgcggccggtcatggctggctcgatctggac
gcggtcgtcctggagagcttgacggccttcaaacgcgcgggggccgacggcgtgttgacc
tactttgcgcttcgcgtcgcccgcctgctgaaccggtga

DBGET integrated database retrieval system