KEGG   Isosphaera pallida: Isop_2634Help
Entry
Isop_2634         CDS       T01407                                 

Definition
(GenBank) hypothetical protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ipa  Isosphaera pallida
Pathway
ipa00630  Glyoxylate and dicarboxylate metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01130  Biosynthesis of antibiotics
ipa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ipa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Isop_2634
Enzymes [BR:ipa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Isop_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: ADV63204
UniProt: E8QZ62
Position
complement(3807183..3808610)
Genome map
AA seq 475 aa AA seqDB search
MSVFSDHFIASLIDDADARETRLRDLLADELPQMPPVVRDDAVIATYFLALRSLTLEKAV
KEIAYHATSGIKNPPPGSLLAACTAESAGARAFDAAGRVGLLRIAFPLQMMLDPEGRLTS
VDLLHTLASAVIFDMYENLDARLLAIDLPEAVLQGFPGPAHGPQGARRLARFPSGRPAFG
TILKPTAGITPEEVGRIVASIASWSHLMFIKEDEDLYPDLPYSPVAERVRHAKAAIARVR
DAGVESGLVYLPHCTATPHRLGDLVEAALEAGADGVMFSESFAGGAVRMIREAHRERQPH
PPLIYGHNAGIGVKTRGGIAREVVDFLARLDGIDFRQTAPIKVGDPYIRPFGREWRASEE
ILSRPLPGINPVMIARAGGLDQGNLLLNIDEVEAQGRLDSVLFLAGSAINSIVNDQGEAD
PALGIAALAELLDLRESGAVRGVPPERHLDTLRQAARAAGHHALIRALDQRYPNR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttttttccgaccacttcatcgcttccttgatcgacgacgccgacgcccgcgaa
acccgtctgcgtgacctgctcgccgacgaattgccccaaatgcccccggtcgtccgcgac
gacgcggtgatcgccacctacttcctggcgcttcgcagcctgactcttgaaaaggcggtc
aaggagatcgcctatcacgccaccagcggcatcaaaaatccgccgcccggcagcctgctg
gccgcctgcaccgccgaatcggctggagcacgcgccttcgatgcggccggtcgggtcggc
ctgctccgaatcgccttccccctccaaatgatgctcgaccccgagggccgtttgaccagc
gtggacttgttgcacaccctggcctcggcggtcatcttcgacatgtacgagaacctcgac
gcccgtttgctggccatcgacctgcccgaggcagtgctgcaaggcttccccggcccagcc
cacggtccccagggcgctcggaggttggcccgcttcccctcaggacgccccgccttcggt
accatcctcaaaccgaccgccggcatcacccccgaggaggtaggccgcattgtcgcctca
atcgccagttggtctcatcttatgtttattaaggaagacgaggatctttatcccgatctt
ccttattcgccggtcgccgagcgggtccgccatgccaaagcggcgattgcccgagtccgc
gacgctggcgtggagagcggcctggtctatctgccccactgcaccgcgaccccccatcgt
ctgggcgacctggtcgaggcggcccttgaagctggggccgatggcgtcatgttctccgag
agtttcgctgggggcgcggtccgcatgatccgcgaagcccaccgcgaacgtcaaccccat
ccccccctcatctacggccacaacgccggcatcggcgtcaagacccgcggcggcatcgcc
cgcgaggtcgtcgatttcctcgcccggctcgacggcatcgacttccgccaaactgctcca
atcaaggtgggcgatccctacatccgtcccttcggccgcgagtggcgggccagcgaggag
atcctgtctcgacccttgcccggcatcaacccggttatgatcgcccgcgccggcggcctg
gatcagggcaacctgttgctcaacatcgacgaggtggaggcccaaggacggcttgactcg
gtgctcttcctggccggttcagccatcaactcgatcgtcaacgaccagggcgaagccgac
cccgctttgggtatcgccgccctcgccgaacttctcgacctgcgcgaatccggcgcggtt
cgcggcgtgccccccgaacgtcacctcgacacactgcgccaagcagcccgcgccgccgga
caccacgcgctgatccgagcgctggatcaacgttaccccaaccgttga

DBGET integrated database retrieval system