KEGG   Isosphaera pallida: Isop_2970Help
Entry
Isop_2970         CDS       T01407                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipa  Isosphaera pallida
Pathway
ipa00010  Glycolysis / Gluconeogenesis
ipa00030  Pentose phosphate pathway
ipa00051  Fructose and mannose metabolism
ipa00052  Galactose metabolism
ipa00680  Methane metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01130  Biosynthesis of antibiotics
ipa01200  Carbon metabolism
ipa01230  Biosynthesis of amino acids
ipa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_2970
   00030 Pentose phosphate pathway
    Isop_2970
   00051 Fructose and mannose metabolism
    Isop_2970
   00052 Galactose metabolism
    Isop_2970
  Energy metabolism
   00680 Methane metabolism
    Isop_2970
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Isop_2970
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Isop_2970
Protein phosphatases and associated proteins [BR:ipa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Isop_2970
Messenger RNA biogenesis [BR:ipa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Isop_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADV63535
UniProt: E8R2A5
Position
4331591..4332985
Genome map
AA seq 464 aa AA seqDB search
MGVRVEKPPLKTTASRRAGLNLLGTLPKMIEPTGRLVEIERLGPATFPTNWRVARRAGDW
SLVDPAVRVRVRADWPLPPDHEELWFERAGPRRWLRFDPTQTKAAIVTCGGLCPGLNNVI
RSVYLELTRNYGVPTVLGIRHGYLGLTAEGPPPEVLTMERVGPIHRMGGTILGSSRGQRD
TAEMAATLERLGITMLFCVGGDGTQRGALAIGREIRAHGKEIAVVGIPKTIDNDLMYTDR
TFGFDTAIQIAHQVIQVAHTEAKAGVRGIGLVKLMGRDSGFIAAMATLACQEVNVTLIPE
VPFRLEGEEGLLAVLERRLDQRGHAVVVVAEGAGQDLFEGGPEALGFDASGNRRYHDIGL
FLKERITDHFKAIGKPADLKYLDPSYIIRSTPAICTDSALCDQLGRDAVHAALAGMTNVV
VTRLNNLPALVPMEMTVSRKRVIDPQGPIWTSVLAATGQPPLLR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggggttagggtggaaaagccgcccttgaaaaccaccgcgtcccgccgcgcggggttg
aacctccttggaacacttccaaagatgatcgaaccgactggacggcttgttgagattgaa
cgtctaggtcccgccacgtttcccaccaactggagggtggcgcgccgagcaggcgattgg
tcgttggtcgatccggcggtccgtgtccgcgttcgggccgattggcccttgccccccgac
catgaggaactttggttcgagcgggccgggcctcggcgttggctccggttcgaccccacc
cagactaaggcggcgatcgtgacctgtggcggcctttgccccggtctgaacaacgtgatc
cgctcggtttatctggaactaacccgcaactacggcgtgcccaccgtgctgggcatccgt
cacggctatctcgggctgaccgccgaggggccaccgccggaagtgctgaccatggagcgg
gtcggtcccattcaccgcatgggcggcaccattttgggcagctcgcgcggacaacgcgac
accgccgaaatggccgccaccctagaacgtcttggtatcaccatgctcttttgcgtcgga
ggggacggcacccagcgcggggcgctggcgattggccgggagatccgcgcccacggcaag
gagatcgccgtggtcggcattcccaaaaccatcgacaacgatttgatgtacaccgatcgc
acctttggtttcgacaccgccattcagatcgcccatcaggtcatccaggtggcccatacc
gaagccaaggccggagtgcgtgggattggcctggtcaagctgatgggacgcgactccggc
ttcatcgcggcgatggccaccctcgcgtgtcaggaggtcaacgtcacgttgattcccgag
gtgccgttccgtctggaaggggaagagggtctgctggccgtcttggaacgccggttggat
caacgcgggcacgccgtggtggtggtcgccgagggggccggtcaggacctcttcgaaggg
ggccctgaagccctcgggttcgacgcctcgggcaaccgtcgctaccatgacatcggcctc
ttcctcaaggagaggatcaccgaccacttcaaagcgatcggcaaacctgccgacctgaag
tatcttgacccaagctatattatccgcagcacaccggcaatctgcaccgactcggcactg
tgcgaccaactgggacgcgacgcggttcacgccgcgttggcgggaatgaccaacgtggtg
gtcacccgtttgaacaatctcccggctctggtgccgatggaaatgacggtctcccgaaag
cgggttatcgaccctcaaggccccatctggacctcggtgctggccgccaccggacaaccc
cccctgttgagataa

DBGET integrated database retrieval system