KEGG   Isosphaera pallida: Isop_3602Help
Entry
Isop_3602         CDS       T01407                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ipa  Isosphaera pallida
Pathway
ipa00340  Histidine metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Isop_3602
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Isop_3602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADV64159
UniProt: E8QYH6
Position
5280300..5281748
Genome map
AA seq 482 aa AA seqDB search
MSAPAPSDLRDRPYPPPGATTLAMPLIDATRDPQTAADTLKALRAKLSPQGDVVSPRGRA
LTREVFGEALAPREVVQRILEQVRTRGCEALLEFTRKLDHADLTPDTLRVSADELAQAHR
AAAPEYLDTIRRVRGHLEAFQTAILHQDITVQRGPGHRLTQRYRPLKRVGVCVPGGAAAY
PSSLMMTVIPARAAGVEQIAVVVPPTAFGGYNANLLAACHELGVTEIYRIGGAQAVAALA
YGVEGIAPVDKIVGPGNLFVALAKQAVYGVVDIDSIAGPSEVVVLADETARPDYLAADLI
SQAEHAPGSSLLITWVEGLAEQVLIHLERQLAGLERGDLARESLEQFGALIRVANRDEAI
ALTNQIAPEHLHISTNQPAEDAERLHAAGAIFLGHDAPVAAGDYAAGPSHVLPTGGTPRW
ASGLCSNDFLKRTSLIEIDHDGLAALAPDITRLADIEGLPGHKLSVTIRLDSRPTPGQPG
QS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccggctccctccgacctccgcgatcgcccctatccccctcccggcgccacg
accttggcaatgcccctcattgacgcgacccgcgacccccagaccgccgccgacaccctc
aaggcgctcagagccaaacttagtccccagggggatgtcgtgagtccccgaggtcgtgcg
ctgactcgggaggtcttcggcgaggcgctggccccccgcgaggtcgtccaacggattttg
gagcaggttcgaacccgcggttgcgaggcgctgctggagttcacccgcaagctcgaccac
gctgatctgacccccgacaccctgcgtgtctccgccgacgaactcgcccaggcccatcgc
gccgctgctccggaatacctcgacacgatccgccgggtccgtggccacctcgaagcgttc
caaaccgcgattttgcaccaggacatcaccgtgcaacgcggccccggacaccggctcacc
cagcgctaccgccctctcaagagggtgggggtctgcgtgccgggcggagcggcggcctat
ccctcctcgctgatgatgacggtcatccccgcgcgggccgccggagtcgaacagatcgcc
gttgtcgtgccgcccactgcgttcggcggctacaacgccaaccttttggccgcctgtcac
gaactgggcgtcaccgagatttatcgaatcggcggcgctcaggcggtcgcggcgctggct
tacggcgtggagggaatcgccccggtggacaagatcgtgggaccaggcaacctgttcgtc
gctttggccaagcaagcagtatacggggtggtcgatatcgactcgatcgccggtcccagc
gaggtggtcgtgctggccgacgaaaccgcccgacccgactacctggccgccgacctcatc
agccaggccgaacacgcccctggctccagcctgctcatcacctgggttgaaggtctggcc
gaacaggtgttgatccacctggaacgccaactcgccggtctcgaacgcggcgacctggcc
cgcgaaagcctggaacaattcggcgcgctgatccgcgtggcgaatcgcgacgaggccatc
gccctgacaaatcaaatcgcccccgaacatcttcacatttccacaaaccaaccggccgag
gacgccgaacgcctgcacgccgccggcgcgatcttcctgggccacgatgctccagtggcc
gctggcgactacgccgctggtccctcccacgtcttgcccaccggcggaaccccgcgctgg
gcttcgggcctgtgctccaacgacttcctcaaacgcaccagcctcatcgaaatcgaccac
gacggcctggccgccctcgcccccgacatcactcggctcgccgatatcgaaggactcccc
ggccacaagctcagcgttaccatccgactcgacagccgcccaacccccggccagcccggc
caatcctaa

DBGET integrated database retrieval system