KEGG   Idiomarina piscisalsi: CEW91_00540Help
Entry
CEW91_00540       CDS       T04931                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ipi  Idiomarina piscisalsi
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ipi03009]
    CEW91_00540
Enzymes [BR:ipi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CEW91_00540
Ribosome biogenesis [BR:ipi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CEW91_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_23 Ubie_methyltran Methyltransf_32 MTS Methyltransf_29 Methyltransf_33 Methyltransf_8 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ASG64730
Position
121423..122256
Genome map
AA seq 277 aa AA seqDB search
MIQPFDQLICPLDKQPLQLNERTWCCENGHSYDVAKQGYVNLLPVQNKRSKDPGDSKAMV
QARREYLSKGCYQPLAQALADTVLAMGSQALLDAGCGEGYYLRYLVEQAEQTETELSVAA
LDISKWAVQAAAKQDKRLSWMVASNNAIPLADNSVDTILCVFGFPVEAEFKRVLKPGGRL
IMVDPAVNHLTELKAIIYPELKNKSETLPITDPDYELTSEQRVNFQVELDNNDSIKNLLT
MTPHLYRASKEGRERAESLQSLTITVDAWVRTFRVST
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgatacagccgtttgaccaactcatttgccctctggacaagcaacctttgcaactgaac
gagcgcacctggtgctgtgaaaacgggcatagctatgacgtggcaaaacagggctacgtg
aacttgctgccggtccagaataaacgctcgaaagaccccggtgacagcaaagcgatggta
caggcaaggcgggaatacttgagtaaaggttgctaccagccgcttgcgcaggcattagct
gatacagtgttagcaatgggctcacaggctttactcgatgcgggttgcggtgaagggtat
tacttgcgctatcttgttgaacaggccgagcaaacagagacagagttaagtgtggccgct
ctggatatttcaaaatgggcggtacaggcagcagcaaagcaggataagcggttgagctgg
atggtggcatcgaataacgcgattccgctggcagacaatagtgtcgataccattttgtgc
gtatttggtttcccggtagaagctgagtttaagcgggttttaaaaccgggtgggcgattg
attatggttgatccggcggtgaaccatctaacggagctaaaagccataatttaccctgag
ctaaagaacaaaagtgagacgttgccgataaccgacccagattatgaactgacttcagaa
caacgtgttaactttcaggttgaactggataataacgactccattaaaaacctcctgact
atgacgcctcacctctaccgcgctagtaaagaaggcagggagcgagcagaaagcttacaa
agcttgaccataacggtcgacgcctgggtacgaacttttagagtaagcacatag

DBGET integrated database retrieval system