KEGG   Idiomarina piscisalsi: CEW91_04310Help
Entry
CEW91_04310       CDS       T04931                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ipi  Idiomarina piscisalsi
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEW91_04310
Enzymes [BR:ipi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CEW91_04310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ASG65407
UniProt: A0A241R2J1
Position
886125..886952
Genome map
AA seq 275 aa AA seqDB search
MTLYDLHCHSTHSDGSLSVKELLHRACEYNVDVLALTDHDCIEGIAEAKALIEKEQLPLR
FINGVEISCRWESFEIHIVGLNFDPDNEHLKGLLAQQQQRRYDRFAAILEKLEKRGVMLS
AEECQVDGMPTRKHIADTLVEKGIVSHPQKAFDHYLGKGNSAYVTPQWCDIPEAIESIHK
AGGQAILAHPHAYKMSNKWLRRLLIEGKEWGLDGMEVSLSQQSPGHRDALAKMSQEYGLK
ASQGSDFHYPGNWRELGKNLCLPADCVPIWEHWSH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactttatacgacctgcattgtcatagtacgcattcagacggctctttgtcggtcaaa
gagctactgcaccgtgcctgtgagtacaacgtcgatgtactggcgttaaccgaccatgac
tgcattgaagggattgctgaggcgaaagcactgatcgaaaaagaacagctgccgcttcgg
tttatcaacggcgtggaaattagctgccgttgggaaagttttgaaattcatattgttggt
ttgaactttgaccccgacaacgaacatttaaaaggtttgctggcgcagcaacaacagcgt
cgctatgaccgctttgctgccattttagaaaagctggaaaagcgtggtgtcatgttgtct
gctgaggaatgtcaggttgacggcatgccaacacgcaaacacatagccgataccctggtc
gaaaaaggcattgtcagtcatccgcaaaaagcgtttgatcattaccttggaaagggcaac
agcgcttacgtgacgccgcagtggtgtgatattcctgaggctattgaatccattcataag
gcgggtggccaggcaattctggcgcatcctcatgcgtacaaaatgtcgaataaatggctg
cgtcgtttgctgatagaaggcaaagaatggggtcttgacggtatggaagtcagcctgagc
cagcagtcaccgggacaccgtgatgcactggctaaaatgagtcaggaatatgggttaaaa
gcgtctcagggctctgactttcattacccgggtaattggcgtgagctcggtaaaaacctt
tgtctgccagccgactgtgtgccaatatgggagcattggtcacactag

DBGET integrated database retrieval system