KEGG   Idiomarina piscisalsi: CEW91_07585Help
Entry
CEW91_07585       CDS       T04931                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ipi  Idiomarina piscisalsi
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ipi03016]
    CEW91_07585
Enzymes [BR:ipi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CEW91_07585
Transfer RNA biogenesis [BR:ipi03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CEW91_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ASG66013
UniProt: A0A241R4V4
Position
complement(1563183..1563908)
Genome map
AA seq 241 aa AA seqDB search
MRPPLDIVYQDNDLAVINKPSGLLVHRSRIASEAREFAMQMLRDQIGQHVYPVHRLDRPT
SGLLIFALSSEVATKMSESFATNQVSKQYHAVVRGYLPEEGTVDYPLKEELDKIADAQAD
QNKEAQDAVTHFRCLEKIELPYKVSKKHDTTRYSLVELTPETGRKHQLRRHMAHLRHPII
GDTNHGDGRHNRFFREHFDSHRLLLAATAVEFKHPVNGEMMFLTAPLPDEFLKVFQPAEA
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccacctctggatattgtttatcaggataatgatttagccgtcattaacaaaccc
agcggtttactagttcaccgcagtcgcatagcgagcgaggccagagagtttgctatgcaa
atgctgcgcgaccaaattggtcagcatgtgtacccggttcatcgcctggacagaccaacg
tcagggcttttaattttcgcgctaagcagtgaagtagccacgaaaatgtcggagagcttt
gcgactaaccaagtgagcaaacaataccacgcggttgttcgtggctacttgcctgaagaa
ggtactgtcgattacccgttaaaagaagagctggataaaattgctgacgcgcaggccgat
cagaacaaagaggctcaggacgctgtcacgcatttccgctgcctggagaaaatagagtta
ccgtataaagtcagtaaaaagcacgataccacacgttattctctggtcgagttaactcct
gaaaccgggcgtaagcatcagttgcgtcgacatatggcgcatcttcgccacccgattatt
ggtgacacgaaccatggagacggtcggcataatcgcttctttagggagcattttgacagt
catcgcttactattagcggcaacggcagtagaatttaaacacccggtaaatggcgaaatg
atgtttctgactgcgccacttccggatgagtttcttaaggtctttcagccagccgaagcc
ggctga

DBGET integrated database retrieval system