KEGG   Idiomarina piscisalsi: CEW91_07655Help
Entry
CEW91_07655       CDS       T04931                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ipi  Idiomarina piscisalsi
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ipi03009]
    CEW91_07655
Enzymes [BR:ipi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CEW91_07655
Ribosome biogenesis [BR:ipi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CEW91_07655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ASG66027
Position
complement(1576164..1577249)
Genome map
AA seq 361 aa AA seqDB search
MSGIILLCRAGFEGDCAAEIQDKATELGIYGYCQTQPNQAYVTYNCQAEEAEHIARKLPL
KDLVFAREMFALLSPVKLAGIEDRASEVIKALEPHRETFGLAGELRVETPDTNEANQLSK
FCRKFSVPLRQALRKEELLSNKPLAKRPLLHVLFVNSAHALVGYSYSYNQTPYDGGILRL
RMPKDGPSRSTLKLDEAFQVFVPENEQEKRIQPGMKAVDLGAAPGGWTYQLVRRGMMVQA
VDNGPMADSLMETGQVQHIKEDGFKFRPKRKNIHWLVCDMVEKPARVGELMTSWLLEGDC
QEAIFNLKLPMRQRYAAVKEYLDQIKDQLQTEGTKPFEIQAKHLYHDREEVTVHLRWLPK
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattattttattgtgtcgcgctggttttgaaggcgactgtgcagcagaaata
caagacaaagcaacagaacttggtatttacggttattgccagacacagccgaaccaggcc
tatgtcacttataactgtcaggctgaagaagcggagcacattgcgcgcaaactgccatta
aaggacttggtgtttgcccgcgaaatgtttgcgttgttaagtccggttaaactggcaggt
attgaagatcgcgccagtgaggtcataaaagcgctagagccacacagggaaacctttggt
ctagctggtgagctgcgggttgaaacgcctgatacgaatgaagccaatcagctgtcgaag
ttttgtcgtaagtttagtgttccgcttcgtcaggcgttgcgtaaagaagagctattaagc
aataagcctttggcaaaacgccctttactgcacgtgctttttgttaattctgcgcatgcc
ttggttggttattcttatagctataaccagaccccttatgacggtggtattttacgttta
agaatgccaaaggacggaccgagccgttcaacgttgaagcttgatgaagcctttcaggtt
tttgtgcccgaaaatgagcaggaaaaacgtatccagcccggtatgaaagccgttgattta
ggggccgcgccggggggctggacctatcagctggtgcgtcgcggcatgatggtacaagcg
gttgataatggtcctatggctgactcgttaatggaaaccgggcaggttcagcatataaaa
gaagatggctttaagtttcgccctaagcgcaaaaatattcactggcttgtctgcgatatg
gtggaaaagcctgcgagagtcggcgaattgatgacgagctggttgttagaaggtgactgt
caggaagcgatttttaacctgaagctacccatgcgtcagcgctacgctgccgtaaaagag
tatttggatcagataaaagatcagctacaaacagaaggcacgaagcctttcgaaattcag
gcgaaacacctgtatcacgaccgtgaagaagtcacggtacacttacgttggttgccaaag
cagtaa

DBGET integrated database retrieval system