KEGG   Idiomarina piscisalsi: CEW91_07705Help
Entry
CEW91_07705       CDS       T04931                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ipi  Idiomarina piscisalsi
Pathway
ipi00071  Fatty acid degradation
ipi00072  Synthesis and degradation of ketone bodies
ipi00280  Valine, leucine and isoleucine degradation
ipi00310  Lysine degradation
ipi00362  Benzoate degradation
ipi00380  Tryptophan metabolism
ipi00620  Pyruvate metabolism
ipi00630  Glyoxylate and dicarboxylate metabolism
ipi00640  Propanoate metabolism
ipi00650  Butanoate metabolism
ipi00900  Terpenoid backbone biosynthesis
ipi01100  Metabolic pathways
ipi01110  Biosynthesis of secondary metabolites
ipi01120  Microbial metabolism in diverse environments
ipi01130  Biosynthesis of antibiotics
ipi01200  Carbon metabolism
ipi01212  Fatty acid metabolism
ipi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEW91_07705
   00630 Glyoxylate and dicarboxylate metabolism
    CEW91_07705
   00640 Propanoate metabolism
    CEW91_07705
   00650 Butanoate metabolism
    CEW91_07705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEW91_07705
   00072 Synthesis and degradation of ketone bodies
    CEW91_07705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEW91_07705
   00310 Lysine degradation
    CEW91_07705
   00380 Tryptophan metabolism
    CEW91_07705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEW91_07705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEW91_07705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEW91_07705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipi04147]
    CEW91_07705
Enzymes [BR:ipi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CEW91_07705
Exosome [BR:ipi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEW91_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASG66037
UniProt: A0A241R4B6
Position
complement(1585718..1586899)
Genome map
AA seq 393 aa AA seqDB search
MSSDSIVIVAANRTPMGGFQGSLSDVAAPNLGAAAIKAALSNSGLSADDISEVIMGNVLP
AGLGQAPARQAMLYADLPRSTGATTINKVCGSGLKAAMMAHDLIKAGSADVVVAGGMESM
SNAPYMLPKGRSGYRMGHGQVLDHMMLDGLEDAYEHKAMGVYAQGTADDYGLDREAMDEF
AIHSLTKAQTAIKDGLFEGEITPVTYSTRKGDVTVDTDEQPGKARLDKIPELRPAFKKDG
TITAANSSSISDGAAALILMREGDAKAKGLTPLARVMGHTTHSQAPSEFTIAPIGAMNSL
LKKLDWTKDDVDLWEINEAFAMVTMLAIQEMKLDASKVNVHGGACALGHPIGASGARLLV
TLLHALKQKGQKRGVTSLCIGGGEAVALAVEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgattccatcgtgattgtggcggctaaccgcacgccaatgggcggttttcag
ggcagtttgagtgatgtggcagcacccaatttgggcgcggcagcgataaaagcagccctt
agtaacagcggcttaagtgccgatgatatttcagaagttatcatgggtaatgtgttaccc
gctggcttaggccaggctccggctcgccaggcgatgctatacgctgatttaccgcgttca
accggggcaaccaccattaataaagtgtgtggttctggcttgaaagccgcaatgatggcg
cacgacttaattaaggcggggtctgctgatgtcgtggttgctggtggtatggaaagcatg
tcaaatgcaccgtatatgttgccaaaaggccgcagcggttatcgtatggggcacggacag
gtgcttgatcacatgatgctggatggtctggaagatgcctacgagcataaggcgatgggt
gtttatgcccagggaacggccgatgattatggtcttgaccgtgaggcgatggatgaattt
gcgattcattcactgactaaagctcaaacggcgattaaagacggtttgtttgagggggaa
attacgccggtaacttactcgactcgtaaaggcgacgtgaccgttgataccgacgagcag
ccaggcaaagcgcgtttggacaaaattcctgaacttcgtcctgcgttcaagaaggacggg
accattactgcagcgaactcaagctctatatccgatggtgcagcggcacttattttaatg
cgggagggtgatgcaaaagcgaaaggtcttacgccgttagcgcgggtgatgggtcacacg
acacattcgcaagcaccttctgagtttaccattgccccgattggcgcaatgaactcgttg
ttgaagaaactggactggacgaaggacgacgttgatttatgggaaattaacgaggccttt
gcgatggttaccatgctggcaattcaggaaatgaaactggatgcgagtaaagtcaatgtg
catggtggcgcttgtgcgttaggacacccgattggcgcaagtggtgctcgcttattagta
acgctgctacatgcactgaaacaaaaaggccagaaacgtggcgtcacctcgctgtgtatt
ggcggcggtgaagccgttgctctggctgtggaaatgctctaa

DBGET integrated database retrieval system