KEGG   Idiomarina piscisalsi: CEW91_11480Help
Entry
CEW91_11480       CDS       T04931                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ipi  Idiomarina piscisalsi
Pathway
ipi00260  Glycine, serine and threonine metabolism
ipi01100  Metabolic pathways
ipi01110  Biosynthesis of secondary metabolites
ipi01120  Microbial metabolism in diverse environments
ipi01130  Biosynthesis of antibiotics
ipi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEW91_11480
Enzymes [BR:ipi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CEW91_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASG66973
Position
2397196..2398209
Genome map
AA seq 337 aa AA seqDB search
MLDLRSDTVTLPSAAMRAAIADATVGDDVYGEDPSINALEKRVAELLGKEDALLCSSGTQ
SNLLGIMSHCRNGDEYIVGQEYHTYRYEAGGAAVLGGVVPQTVEVEADGTLSLDTIEQRI
KPDDPHFPITRLLAFENTHAGQLIDQTYFDEARILADQNGLSMHLDGARLPNAAIASGRS
MAELAAPFDSVSLCCSKGLGAPVGSLLAGSKELIARARRWRKMVGGGMRQAGFVAVAIDY
ALTHQFERIQDDHDNAKWLFEQLSELLAGTEAKVRYSGTNMTFVELPDSLPADGLRELMA
EHDIKLPGGQKLRLVCHLDVSREQLKRFIELFKQWLQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctggacttacgcagtgataccgttacccttccaagcgccgctatgcgtgccgctata
gccgatgcaaccgttggcgatgatgtttatggcgaagacccttccattaacgcgctggaa
aagcgtgtcgctgaattactgggtaaagaagatgccctgctgtgcagttccggtacgcaa
agcaacttactgggtatcatgagtcattgtcggaacggcgacgagtacattgtcgggcag
gagtaccatacctatcgttatgaagccggcggtgctgcggttttaggcggtgtggtacca
caaacagtagaagtggaagcagacggaaccttgtcgctcgacaccattgagcagcgtata
aagccggacgacccgcactttcctattacccgtttactagcatttgagaatacccacgcc
ggccagttaattgaccagacctattttgatgaagcccgaattttggcggatcagaacggt
ttgtccatgcacttagacggcgcacgtttaccgaatgccgctattgccagtggtcgcagc
atggcggaattggctgcgccttttgacagtgtgtctttgtgttgttcgaaaggtttgggc
gctccggtcggatcgttactggcaggctccaaagaactgattgcccgcgcccgtcgctgg
cgcaaaatggtcggcggcggtatgcgccaggcggggtttgtcgctgttgccattgattac
gcgttaacacaccagtttgagcgcattcaggacgaccacgacaatgctaagtggctgttt
gaacaactttcggagctgctagcaggtaccgaagctaaagttcgctattccggcaccaat
atgacctttgttgaactgccagacagtttaccggcagacggcttacgggagcttatggca
gagcatgatattaaattacccggcgggcagaaattacgtctagtgtgtcatttagatgtt
agccgggagcagctcaagcgttttatcgagctgtttaagcagtggctccagtag

DBGET integrated database retrieval system