KEGG   Ilyobacter polytropus: Ilyop_0077Help
Entry
Ilyop_0077        CDS       T01337                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
ipo  Ilyobacter polytropus
Brite
KEGG Orthology (KO) [BR:ipo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ilyop_0077
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Ilyop_0077
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Ilyop_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADO81866
UniProt: E3H6A7
Position
82187..83170
Genome map
AA seq 327 aa AA seqDB search
MNKIIGITMGDPSGIGPEIILKSFFNKKIKSGKYLVIGDYEIIEFFNKKLGLNVKLEKLI
NIDNINFSKDVLSILDLGLIKIENLKIGEVSLNSGNAAFQYLKKAIELAMNGKISGIATA
PLNKEAMNKAGHFYSGHTEILGYYTSTKDYAMLLYDEKLSTIHVSTHVSLKEAIKRTKKE
RVEEVIRLADKTFRKLGLKNPKIAVAGLNPHSGENGLFGMEEIEEIIPAINSSISKGINV
EGPIPPDTVFLKAVEGNYDVVVAMYHDQGHIPLKLLGFNSGVNITVGLPIIRTSVDHGTA
FEIAGKNIANEESMINAINLVHKLSDA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataataggaataactatgggagatccttcaggaataggtcctgaaatcatc
ttgaaaagtttttttaataaaaaaataaaatctggaaaatatctagttattggtgattat
gaaattatagagttttttaataaaaaattaggtttaaatgttaaattagaaaagctgatt
aatattgataatattaatttttctaaagatgttcttagtattttagatttaggattaatt
aaaatagaaaatttaaaaattggtgaggttagtttaaattcaggaaatgctgcttttcag
tatttgaaaaaagcgatagaattagcgatgaatggaaaaatttctgggattgcaacagcg
ccattaaacaaagaagctatgaataaagcagggcatttttattcaggacatacggagata
ttgggttactacacttcaacaaaagattacgcaatgctactttatgatgaaaaattaagt
actatacatgtttcgacacatgtttctctaaaggaagcaataaaaagaacaaaaaaagaa
agagttgaagaagttataagattggcagataagacatttagaaaattaggattaaaaaat
ccaaagatagctgttgcaggtctaaatcctcactcaggggagaatggactctttggaatg
gaagaaattgaggaaataattccggcaataaactcctccatatcaaaaggtataaacgta
gaaggtccaataccgcccgatacagtttttttaaaagcagtggaaggtaattatgatgtc
gttgttgcaatgtatcatgaccagggtcatattcctctaaaattgttgggatttaatagt
ggagttaatataacagtgggattaccaataataaggacttcagtcgatcacggaaccgct
tttgaaatagccgggaaaaatattgccaacgaagaaagtatgataaatgcgataaattta
gttcataaacttagtgatgcttaa

DBGET integrated database retrieval system