KEGG   Ilyobacter polytropus: Ilyop_1545Help
Entry
Ilyop_1545        CDS       T01337                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00010  Glycolysis / Gluconeogenesis
ipo00052  Galactose metabolism
ipo00500  Starch and sucrose metabolism
ipo00520  Amino sugar and nucleotide sugar metabolism
ipo00521  Streptomycin biosynthesis
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01120  Microbial metabolism in diverse environments
ipo01130  Biosynthesis of antibiotics
ipo01200  Carbon metabolism
Module
ipo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ipo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_1545
   00052 Galactose metabolism
    Ilyop_1545
   00500 Starch and sucrose metabolism
    Ilyop_1545
   00520 Amino sugar and nucleotide sugar metabolism
    Ilyop_1545
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ilyop_1545
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ilyop_1545
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ilyop_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADO83324
UniProt: E3H8R0
Position
complement(1657833..1658783)
Genome map
AA seq 316 aa AA seqDB search
MYLAGVDLGGTNTKIGVLDENGEIIKSTSIKTLSSNGPWKTLERIWAAIKKMLQEKNIDE
DDLQGIGLGIPGPVVDNSVVSSFANFPWDDNIDIADMMEKITGKKTKVDNDVNVIALGEA
VYGAAKGYKISVTVALGTGIGGGIYIDGKVLSGATGSGGEVGHMKLVRDGKLCGCGQKGC
FEAYASATGLVREAISRLYINKNNLLYKSIGGKVENLEAKHIFDAALEGDSFSIDLVDYE
AEHLAMGLGNIISIINPEIVVLGGGVAMAGDFLLDKVREKLPEYAYSEAVRNIIIKTGNL
GNDAGIKGAAALLLEK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtatttggcaggagtagatctaggaggaacaaatacaaaaataggtgtgctggatgaa
aatggagaaatcataaaatcaacctctataaaaaccctttcatcaaatggtccttggaaa
accctagaaagaatatgggctgctataaaaaaaatgcttcaagaaaaaaatatagatgaa
gacgatcttcaaggaataggtcttggaataccaggacctgttgtagacaacagcgtagtg
tcgtcctttgccaatttcccttgggacgataatattgatatagctgatatgatggaaaaa
ataacagggaaaaagacaaaggtggataatgatgtcaatgtcatagctttgggagaggct
gtatacggtgcggcgaaaggatataaaataagtgtaacagtggctttagggacaggtata
gggggaggaatctacatcgacggcaaggttctttctggtgctactggttctggtggagaa
gtgggtcatatgaagctagtaagagatggaaaactttgcggctgcggtcaaaaagggtgt
tttgaagcttatgcctctgcaacaggacttgtgagagaggctatttccagactgtatata
aataaaaataaccttctttataagagtatagggggaaaagtagagaatctagaggcaaag
catatttttgatgctgccctagagggagacagcttttccatagatcttgtggattatgag
gctgagcatctggctatgggtttaggtaacataataagtataataaatccagagatagtt
gtcctagggggaggagtggctatggcaggagattttcttttggacaaggtgagagagaaa
ttaccggaatacgcttattctgaagctgtcaggaatatcataataaaaaccggaaatctg
ggaaatgatgcaggtataaaaggggcagcggctttgcttctagaaaaataa

DBGET integrated database retrieval system