KEGG   Ilyobacter polytropus: Ilyop_2009Help
Entry
Ilyop_2009        CDS       T01337                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00250  Alanine, aspartate and glutamate metabolism
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ilyop_2009
Enzymes [BR:ipo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ilyop_2009
Peptidases [BR:ipo01002]
 Cysteine Peptidases
  Family C44
   Ilyop_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase DUF3700 QueC
Motif
Other DBs
NCBI-ProteinID: ADO83780
UniProt: E3HBG5
Position
pILYOP01:76954..78534
Genome map
AA seq 526 aa AA seqDB search
MCGIMYYSGKEAELLGFEKSFERIVYRGPDSTEILKDKGVWGFHRLSIMDLSNSGMQPFM
LDGSISICNGEIYNFRKIKEDLQDKYKFHSDSDCEVLIPLYKEMGVEMFKYLDAEYAMVM
YDAGADEVIAARDPIGIRPLFYGYSKTTKEIAFASEAKGLTDFCEDVAAFPPGHYYKGGE
FICYRDMTKYTQFIDGDLEEITEGIRERLEAGIIKRLDSDAPVGYLLSGGLDSSLVCAIA
QRNLEKPLKTFAIGMEKDPIDLKYAKEVAEYLGTEHTEVTISEKDVLDNLKHVIYCLETW
DITTIRASMGMYLICKYIRANTDIKVLLTGEISDEIFGYKYTDFAPSGEEFQKEAEKRLR
EIYMYDVLRADRCISANSLEARVPFGDLDFVDYVMGINPEKKLNTYNKGKYLLRKAFEGG
EYLPKDILYREKAAFSDAVGHSLVDCIKAFADEKYSDEDVEKAKEKYAYGTPFTKESLLY
RDIFEEFFPGKAEWIKDFWMPNKEWEGCNVDDPSARVLSNYGDSGK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcatgtattattcaggtaaagaagcggaactattaggatttgagaaaagt
tttgaaagaattgtgtatagaggacctgactctacagaaatactaaaagacaaaggggta
tggggatttcacagattatcaataatggatcttagcaacagcggaatgcagccttttatg
ctagacggaagtatttctatatgtaacggtgagatatacaactttagaaaaataaaagag
gaccttcaagataaatataaatttcactcagatagtgattgtgaagtactgattccgttg
tataaggaaatgggtgtagagatgtttaaatatctagatgcagaatacgccatggttatg
tatgatgccggagctgacgaagtaatagctgctagagacccgatcgggataagaccactt
ttttacggttattcaaaaactaccaaagaaatagcatttgcaagtgaggcaaaaggctta
actgatttttgtgaagatgtagctgcatttcctccaggacattactataaaggtggagaa
ttcatatgctacagagatatgacaaagtatacgcaatttatcgacggagaccttgaagag
ataacagaaggtataagagaaagacttgaagcagggataataaagagattagattctgat
gcaccagtcgggtacctattgagtggaggtttagattcaagtttagtttgtgcaattgct
cagagaaatcttgaaaagcctttaaagacttttgcaatagggatggaaaaggatcctata
gatcttaaatatgccaaagaggtagctgaatacctgggaactgagcatacagaggtaact
atcagcgagaaagatgttttagataacttaaagcatgtaatatactgtcttgagacttgg
gatataacaactattagagcaagtatgggaatgtaccttatttgtaaatatataagagca
aatactgatatcaaagttctattgactggtgaaatcagtgacgaaatatttggatataaa
tatacagattttgcaccaagtggagaagagttccaaaaagaagcggaaaaaagacttaga
gagatctatatgtatgacgtactaagagctgacagatgtatatcagcaaactctctagag
gctagagtaccttttggtgacttagattttgtagactatgtaatggggatcaatcctgaa
aaaaaattaaatacatataacaaaggtaaataccttcttagaaaggctttcgaaggtgga
gaataccttccgaaagacattttatacagagaaaaagcagcctttagtgacgctgtagga
cactcattagttgactgtatcaaggcatttgctgatgaaaagtattctgatgaagatgta
gaaaaggcaaaagaaaaatatgcttatgggactccatttacaaaagaatcactgctatac
agagatatctttgaagagttcttccctggtaaagcagagtggataaaagacttctggatg
ccaaataaagagtgggaaggttgtaacgtagacgaccctagtgcaagagtattatcaaac
tatggtgacagtggaaagtaa

DBGET integrated database retrieval system