KEGG   Ilyobacter polytropus: Ilyop_2415Help
Entry
Ilyop_2415        CDS       T01337                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01130  Biosynthesis of antibiotics
ipo01230  Biosynthesis of amino acids
Module
ipo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2415
Enzymes [BR:ipo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ilyop_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADO84174
UniProt: E3HDI8
Position
pILYOP01:524149..524922
Genome map
AA seq 257 aa AA seqDB search
MILDEIVKSKKEYLKKLSLDKNKLAEIAENMDTPPSFYEAMKKSGLSIIGEVKKASPSKG
VIKEMFDHKAIAAVYDTCVDAISVLTEVEYFKGNPKYLKEVSEITKLPTLCKDFIIDEAQ
IYEARTLGASAVLLIVSILDDETLKNFIAIARELKMEPLVEAHSGEEVKRALKAKAKIIG
INNRDLKTFNVDLNNCIELSKNIPEDVLVIGESGISKREDVKKLKDGKISGVLIGEAFMR
SESINKLARELKEEFND
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgaaattgtaaaatctaaaaaagaatatctaaagaaactatccctagat
aaaaataaacttgctgagatagcagaaaatatggatactccaccgagtttttatgaagct
atgaaaaaaagtgggctttctataataggtgaggtaaaaaaggcttctccgtctaagggt
gtaataaaggaaatgtttgatcacaaggctatagctgcagtatatgacacctgtgtagat
gcaatatctgttctcacagaggttgagtatttcaaaggaaatcctaaatatctgaaggaa
gtttcagagatcacaaaacttcctactttatgcaaagactttataatcgacgaagctcag
atatatgaggctagaactcttggagcctctgcagtacttctcattgtaagtattttagat
gatgaaaccttaaagaacttcattgctatagctagagaattgaaaatggagccccttgta
gaggcccacagcggtgaggaagtaaaaagagctctaaaggcaaaggctaaaataattgga
ataaacaacagagacttaaagacctttaatgtagatctaaacaactgcatagaactttct
aaaaatataccagaagacgtactggtaataggtgaaagtggtataagtaaaagagaagat
gtaaaaaaactcaaagatgggaaaataagcggtgtccttataggtgaagcctttatgaga
tccgaaagtataaataaactggcccgggaattaaaggaggaatttaatgactga

DBGET integrated database retrieval system