KEGG   Ilyobacter polytropus: Ilyop_2418Help
Entry
Ilyop_2418        CDS       T01337                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00260  Glycine, serine and threonine metabolism
ipo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01130  Biosynthesis of antibiotics
ipo01230  Biosynthesis of amino acids
Module
ipo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_2418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2418
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ilyop_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADO84177
UniProt: E3HDJ1
Position
pILYOP01:526688..527440
Genome map
AA seq 250 aa AA seqDB search
MGRIENALKKGEKNLIAYLTAGDPCIEKTPELVLGMESGGAALVEIGIPYSDPLADGPVI
QAASTRALSKDISIEKIFDAVEKIRKESQIPLVFLVYYNTIHNYGGEEFLKKCEETGVDG
LIIPDLPMEEQKELPKNAAVSIIPLVALNSGDRIENIVKDATGFVYCISSFGVTGTRDTI
SNKASEIVSEIKKYTDIPVALGFGISHNKMVEDVNRYADAAIVGSAIVKVIEKTKGSAKE
VEDFVASLLR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaattgaaaatgcactgaaaaaaggagaaaaaaatcttatagcgtatctcact
gcaggtgatccatgtattgagaaaactcctgagcttgtactaggcatggagagtggaggt
gcagcacttgtagagataggtatcccatattcagatcctctagcagacgggcctgtgatt
caggctgcttctacaagggctctgtcaaaggatatttccattgagaagatttttgatgca
gtagaaaaaataagaaaagaaagtcagatacctttggtttttttagtctactataataca
atacataattatggtggggaagaatttcttaaaaaatgtgaggaaacaggtgtagacggc
cttattattcctgacctgccaatggaagagcaaaaagaacttccaaaaaatgcagcagta
agtataattccacttgtggctcttaattcaggtgatagaatagaaaatattgtaaaagat
gctacaggatttgtttattgtatttcctcatttggagttacaggtacgagagataccata
agtaataaagcttctgaaatagtttctgagattaaaaaatatacagatatacctgtggct
ttaggttttgggatatctcacaataaaatggttgaagatgtaaacagatatgccgatgca
gctatagtgggaagtgctattgtcaaggtaatcgaaaaaacaaaaggcagtgcaaaagaa
gttgaagattttgtagcttccctgctaagataa

DBGET integrated database retrieval system