KEGG   Ilyobacter polytropus: Ilyop_2797Help
Entry
Ilyop_2797        CDS       T01337                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00564  Glycerophospholipid metabolism
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
Module
ipo_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ipo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ilyop_2797
Enzymes [BR:ipo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Ilyop_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase EP400_N
Motif
Other DBs
NCBI-ProteinID: ADO84552
UniProt: E3HDE9
Position
pILYOP01:complement(950811..951713)
Genome map
AA seq 300 aa AA seqDB search
MKFEKINYRDRKTGEIKQEKVPGENYLKFLYYNPLGKLTLESIVKRKFLSSLYGRIMDKK
KSCEKIQNFVKNNNINMEESVKNIEEFQSFNDFFVRRLKEGARKVSETKDDLSSPADGKI
LAYENIEKKDQFFLKGSKFSLGGFLRDDKLAQKFQGGTFIIVRLAPSDYHRFHFPASGKI
SGSKKIEGYYYSVSTHAIKKNFMIFCENKREYSILDTKEFGEILLSEIGATMVGGIKQTY
ISNTFVKKGDEKGYFYFGGSTCIMLFEKGKVKIDKDIVENTLQGVETKVYMGEKIGSSVK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaaaataaactacagagatagaaaaaccggagaaataaaacaggagaag
gttcccggagaaaattatttgaagttcttatattacaacccattggggaaattgaccctt
gaatctatagttaagagaaaatttttatcatccctgtatggtagaataatggacaaaaaa
aaatcatgtgaaaagatccaaaattttgtcaaaaataacaatataaatatggaagaatca
gttaaaaatatagaggaatttcaatcttttaatgattttttcgtcagaaggctaaaagaa
ggtgcaagaaaagtatcagaaactaaagatgacctttcgtctccagcagacgggaaaata
ttagcctatgaaaatatagagaaaaaagatcaattttttctaaagggatcaaaattttct
ctaggtggatttttaagggatgacaaattagcccagaaatttcaaggtggaacctttata
atagtaagactagcaccctctgactatcatagatttcattttcctgcaagcggaaaaatc
agtggtagtaaaaagatagagggctattattattcagtttcaactcatgcaataaagaaa
aattttatgatattttgtgaaaataaaagagagtattcaattctagatactaaagaattt
ggagaaatattgttaagtgagattggtgcaacaatggttggaggaataaaacagacttat
atctcaaatacctttgtaaaaaaaggcgatgaaaaagggtatttttattttggtggatcg
acctgtattatgttgtttgaaaaaggaaaagtaaagatcgataaagatatagttgaaaac
actttacaaggagttgaaactaaggtatatatgggagaaaaaataggaagttctgtaaaa
taa

DBGET integrated database retrieval system