KEGG   Ictalurus punctatus (channel catfish): 100528628Help
Entry
100528628         CDS       T04658                                 

Gene name
ary1
Definition
(RefSeq) arylamine n-acetyltransferase pineal gland isozyme nat-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00232  Caffeine metabolism
ipu00983  Drug metabolism - other enzymes
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100528628 (ary1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100528628 (ary1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100528628 (ary1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100528628
NCBI-ProteinID: NP_001187827
UniProt: E3TFT8
Position
27
AA seq 290 aa AA seqDB search
MDLQEYFRRIGFGGTYEKPDLATLRTVHEPHVMSVPFGNLSIHCGERNTMDLQIIYEKIV
RNRRGGWCCENNLLFSWVLREMGYKYTTLGSRVFKTFKNDFGPMDSHLINMVEIEGKPYI
ADVSFGLLYQIWHPLEMIAGKDQEQPAGIFRLLNDGEKWMLEKTGRKPLVQNEAFANSSL
ITKRLTTMLYSFVLTPREIDHFLNTSEYLQTSPESLFTQKSICSLQTPTGFRALIGWTFS
EVTFNPEEDTDMYEMRDLFDSEIETILKEKFNIVLVNKLTPINNKTANNL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggatcttcaggaatacttcagaaggattgggttcggcgggacgtacgagaaacccgat
ctggccacgctccgcaccgtccacgagccgcacgtgatgagcgttcccttcgggaacctc
agcatccactgtggagagaggaacaccatggacctgcagatcatttatgagaagattgtg
agaaaccgtcgtggaggatggtgctgtgaaaacaacctgctcttctcctgggtgctgaga
gagatgggctacaaatacaccacgctgggctctagagtcttcaaaacgttcaaaaatgac
ttcggccccatggattcacacctcattaacatggtggagatcgaaggcaagccgtatatc
gcagacgtgagttttggactgttgtaccaaatctggcacccgttagaaatgatcgcaggg
aaagatcaagagcagccggcggggattttccgcctgttgaacgacggtgagaagtggatg
ctggagaagactggaaggaagccgctggtccagaatgaagccttcgccaattccagcctc
attaccaagcgcctgacgacgatgctgtactcttttgtgttaacaccgcgtgagattgac
cattttctgaacacaagcgagtacctgcagaccagccccgagtctctgttcacccagaaa
tccatttgttccctccagacccccactggattcagagctctgattggttggaccttcagt
gaagtcacatttaaccctgaggaagacacggacatgtatgagatgagagatctatttgac
agcgagatagagactatactcaaggaaaagtttaatatcgttttagttaataaactgaca
ccaataaacaacaaaactgcaaataatctgtag

DBGET integrated database retrieval system