KEGG   Ictalurus punctatus (channel catfish): 100528787Help
Entry
100528787         CDS       T04658                                 

Gene name
ppp1r7, pp1r7
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ipu01009]
    100528787 (ppp1r7)
Protein phosphatases and associated proteins [BR:ipu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100528787 (ppp1r7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 100528787
NCBI-ProteinID: NP_001187986
UniProt: E3TGG0
Position
20
AA seq 345 aa AA seqDB search
MATLSVSEPQEMEVDRRGESEESGDDETKRRSVNGEVEDLQRASTAPEELPVDMDTITLD
PNEEDVDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKNIENLESLVSLRELDLYDNQIRKL
ENLQALTELEQLDVSFNLLRKIEGLERLTKLKKLFLLHNKITNISNLEHLTGLQMLELGS
NRIRIIENLDTLTSLDSLFLGTNKIAQLQNLDGLYNLTVLSIQSNRITKLEGLQNLGNLK
ELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLD
ELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFIRF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctatctgttagcgagcctcaggagatggaagttgacaggaggggcgagtcg
gaggagtccggcgatgacgagaccaagaggaggagtgtcaatggagaagtcgaagacctg
cagcgagcttccacagctccagaggagttgccagtcgatatggacaccatcaccctcgac
cctaatgaggaggacgtggatctggtccactgtcggatcgggaagatcgaaggactcgag
gtcttgcagaaagctaagacgctttctctcagacaaaacctgattaaaaacatagagaac
ctggagagcctggtctcgctgagggaactggacctgtacgacaaccagatccgcaaactg
gagaacctgcaggctttaaccgagctcgagcagctagacgtatcgttcaacttgctgagg
aagatcgaaggtttggagcgtctgacgaagctgaagaagctcttcctgctgcacaacaag
atcacgaacatcagcaacctcgaacacctcaccggccttcaaatgctggagctcgggtcc
aatcgcatcaggatcattgagaacctggacacgctcacgtctctggacagtttgttcctc
ggtacgaataagatcgctcagctgcagaacctggacgggctctacaacctgacggtcctc
agcatccagagcaaccgcatcaccaaactagagggactgcagaacctggggaacctgaag
gagctctacctgagtcacaacggcatcgaggttatcgaaggcctcgagaacaacaaaaaa
ctgacgactctggacatcgcagcgaacaggataaagaagatcgaaaacatcagtcacctc
acagatctgcaggagttttggatgaatgataatcagatagagaattggagcgatctggac
gagctgaagaacgctaaaggtttagagacggtgtacttggaacgcaacccgctgcagaag
gaccctcagtatagacgcaagatcatgctggcattgcccagcgtccggcagatcgatgcc
accttcatccgcttctga

DBGET integrated database retrieval system