KEGG   Ictalurus punctatus (channel catfish): 100528810Help
Entry
100528810         CDS       T04658                                 

Gene name
blvra, biea
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00860  Porphyrin and chlorophyll metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100528810 (blvra)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100528810 (blvra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 100528810
NCBI-ProteinID: NP_001188009
UniProt: E3TGJ1
Position
7
AA seq 291 aa AA seqDB search
MFGCVVVGVGMAGRVRIRDLLTPLPSSTAEIFTLKGLVSRRTVEQQGVQQIPLEEALSRS
DIQVALLCTENVSHEEYISRFLEAGNHVCVEYPMALSYSAAANLLDQAQQKGLVLHEEHI
ELLTPDFKQLKKDIAGKQLEEGSLHFTGGPLKSGFGFLSFSGIARLTWLVDLFGELSVKE
ASMVEEPERKHTKMTVRLLTKDQKPLTWTEERAEGLSRGKRIHLRFTTCTLTELPSGVQE
PVGIFMQDLVLFGSKLQGTIPAEQLQAERNRILHCFKLAEDIRTLCQDNTK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtgtgtggtggtaggcgttggcatggcaggccgggtcaggatccgagacctt
ctcacgcctctgccatccagcactgcagaaatcttcactcttaagggcttggtgtctagg
aggacagtggagcagcagggagtccaacagatccctttagaggaggcgctgagccgcagc
gacattcaggtggccttgttgtgcacggaaaacgtcagccacgaagaatacatcagccgg
tttcttgaagcagggaatcatgtgtgtgtggagtatcccatggccctcagctacagtgct
gccgctaacctgttggaccaagcgcagcagaagggtttggtcctgcacgaggaacacatc
gagctcctcacgcccgacttcaagcagctgaagaaagacatagctgggaaacagctggaa
gagggaagcctgcatttcacaggaggtccgctcaagagcggattcgggttcctgtcgttc
agcggcattgcccgcctcacctggctggtggatcttttcggagagctcagcgttaaagag
gcgtcaatggtcgaggagccggagaggaagcataccaagatgacggtccgcttgttaacc
aaggatcagaaacccttgacctggacagaggagcgcgctgaaggcctgagccgtggcaaa
cgcatccacctgcgcttcaccacgtgcacgctgaccgagctgccgtctggagtccaggag
cccgtgggaatcttcatgcaggacctagtgctgttcgggagcaaactgcaaggcaccata
ccggccgaacaactccaggctgagcggaacagaatccttcactgcttcaagctggcggag
gacatcaggacactctgccaggacaacacgaaataa

DBGET integrated database retrieval system