KEGG   Ictalurus punctatus (channel catfish): 108254751Help
Entry
108254751         CDS       T04658                                 

Gene name
abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108254751 (abhd6)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108254751 (abhd6)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S33
   108254751 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Lipase Thioesterase
Motif
Other DBs
NCBI-GeneID: 108254751
NCBI-ProteinID: XP_017305513
UniProt: W5U8H8
Position
21
AA seq 339 aa AA seqDB search
MDPDVVNMFIIAGGTLAIPILAFVASFLLWPAALFKIYYWYWRRRLGLQVDYAEHDGYRF
CYTHRGKPGSRPSILMLHGFSAHKDMWLAVVKFFPTNVHLVCVDMPGHAGTTRTSAVDYS
IEGQVKRIHQFVECVKLNKKPFHLVGTSMGGCVAGVYAARYPSDLSSLTLICPAGLKCPK
ESEFVRRLRDLENSTDVPRIPLIPSTPEEMEDMLKLCSFVRFKIPHQILQGLVKVRIPHN
NFYHEVFMELVGEKSRHCLHDNMHLISTPLQVIWGKQDQVLDVSGASLLADTLPGCQVDL
LDNCGHSVVMERPRKTAHLIMDFLTRQQNWGSGSNKKLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacgttgtgaacatgttcatcatcgctggaggcacccttgcaatccccatt
ttagctttcgtggcttcttttctgctttggcctgcagcgcttttcaagatttattactgg
tattggaggaggagactggggctgcaggtggattatgcagagcatgacggatatcgcttc
tgttacacacaccgtgggaagcccggcagtcggccttctatacttatgcttcatggcttt
tctgctcacaaagacatgtggctggctgtggtgaagttctttccaaccaatgtgcatctg
gtgtgtgttgacatgcctggccatgcgggcactacgcgcactagtgcagtggactactcc
attgaaggccaggtcaaaaggatacatcagtttgtggaatgtgttaagctgaataagaag
ccttttcacctggtgggtacatccatgggtggttgtgtagctggggtttatgctgctcgc
tatccatctgatctgtccagtctcacactgatctgtcctgctggtctgaaatgccccaag
gagagtgaatttgtgagacgtttgagagacttggagaacagcacagatgtcccaagaatt
cctctcatcccctcgactccagaggaaatggaggatatgctgaagctttgctctttcgtg
cgctttaagatccctcatcagatccttcagggattggtcaaagtccgtattccacacaac
aacttctaccatgaggtgttcatggagttagtaggagaaaaatccagacactgcctgcat
gacaacatgcacctcatttcaacaccacttcaagtcatttgggggaagcaagatcaggtg
ctagatgtatctggtgcatctttgctggctgatactttgcccggatgtcaggtcgatctg
ttagacaactgtggccattctgtggtgatggagcgtcctcggaaaactgctcatctcatc
atggacttcctcacgcgccagcagaattggggaagcggtagcaacaaaaagctctcttga

DBGET integrated database retrieval system