KEGG   Ictalurus punctatus (channel catfish): 108255116Help
Entry
108255116         CDS       T04658                                 

Gene name
mapkapk2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04218  Cellular senescence
ipu04370  VEGF signaling pathway
ipu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108255116 (mapkapk2)
   04370 VEGF signaling pathway
    108255116 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108255116 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108255116 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108255116 (mapkapk2)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108255116 (mapkapk2)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   108255116 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 108255116
NCBI-ProteinID: XP_017306290
UniProt: W5UD67
Position
21
AA seq 379 aa AA seqDB search
MLSNSQNQLVFPNQPQQQQQHLQFHAKPALQIKKNAITDDYKVTNQVLGLGINGKVLEIV
QKKNGEKYALKMLQDCPKARREVELHWRASPCTHIVRIIDVYENLYQGRKCLLIVMECMD
GGELFSRIQDRGDQAFTEREASDIMKSIGEAILFLHSINIAHRDVKPENLLYTSKRPNAV
LKLTDFGFAKETTTLNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPP
FYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEAKHLIKRLLKTEPSMRITISEFMNH
PWINQSMEVPQTPLHTSRVLKEEKDVWEEVKEEMTSALATMRVDYEQIKIKTIEDSSNPL
LMKRRKKANMAAENQTSNS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaactcgcagaaccagctggtattccccaaccagccacaacaacaacagcag
caccttcagttccacgccaaacccgcgcttcagataaagaaaaacgccatcacggacgac
tacaaggtcaccaaccaggtcctgggtttgggcatcaatgggaaggtgttggaaatcgtt
cagaagaagaacggggagaagtacgcgctgaagatgctgcaggactgtcccaaagccagg
cgtgaggtagagttgcactggcgagcatcaccctgtactcacatcgtgcgtatcattgat
gtatacgagaacctataccagggccgcaagtgcttactcatcgtcatggagtgtatggat
ggcggggagcttttcagtcggattcaggaccgaggggaccaggcattcactgagagagag
gcttcagatatcatgaagagtattggagaagccatcctgttcctgcactccatcaatata
gcacacagagacgtcaagccagaaaacctcttgtatacatcaaaaagacccaacgctgtc
ctcaagctcacagactttgggtttgccaaagagacgaccacacttaattcgctgaccacc
ccatgttacactccctattacgtcgcccctgaggtgcttggtccagaaaagtatgacaag
tcctgtgatatgtggtctttgggtgtcatcatgtatattctgctctgtggctacccacct
ttctattccaatcatggactggccatatcacctgggatgaagaagaggatccgcatggga
caatacgagtttcccaatcccgaatggtccgaagtctcagaagaagccaagcatctcatc
aagaggttgctaaagacagagccctcaatgaggataaccatatcagagtttatgaaccat
ccctggatcaatcagtcgatggaagtgccacagacccctttgcacaccagccgtgttctg
aaagaagagaaagatgtctgggaggaagtcaaggaggaaatgactagtgccttggccacc
atgagggtggactacgagcagatcaaaatcaagaccattgaggactcctccaatccactg
ctgatgaagaggagaaagaaagcaaacatggccgctgaaaatcagacatccaacagctga

DBGET integrated database retrieval system