KEGG   Ictalurus punctatus (channel catfish): 108255276
Entry
108255276         CDS       T04658                                 

Gene name
asic1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108255276 (asic1)
Ion channels [BR:ipu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   108255276 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 108255276
NCBI-ProteinID: XP_017306601
UniProt: A0A2D0PMF5
Position
21
AA seq 556 aa
MVRITCTISVTTGDEPTGGSYASSFDDHYKRVARSGESDLGNYKEESGELEVYEEEEEEP
PNIDLANFFSGCTLHGANHVFVENKKFGVRQGLWAVSFLLALCMFLMQVGDRVVYYVQYD
HVTMLDERNAPNMTFPAITLCNFNTFRRSQVSYSDLLFMGPLIGYEDNMAPGFQLAPEPD
RQGARFSMAEFYNRTRHRMEDILLECTFAGKDCGPEHWREIFTRYGKCYTFNSGQDGQPL
RVTTKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFGVA
PGFQTFVSCQEQRLTYLPPPWGDCRSEPIDSDFFTTYSITACRIDCETRYLVENCNCRMV
HMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRYGKELSFVKIPSKASAK
YLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELPGLLGDIGGQMGLFIGASIL
TVLELFDYLYEVIKYKLCRCRKQNQKRSNNNDRGAVLSLDNVQCHPPCENLRTPSTYPAN
ILPHHPGQGNFEDFTC
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggtgcgaattacatgcacgatctctgttacgacaggagatgagcccactggggggtcc
tacgcgagcagctttgatgatcactacaaacgggtagcgcggagtggagaaagcgatctg
gggaattacaaggaagagagtggtgagctggaggtttacgaggaggaggaagaagagcca
cctaacattgacttggcaaacttttttagtggttgtacccttcacggtgccaaccacgtc
tttgtggagaataagaagtttggggtgaggcagggtctctgggcggtgtcattcctgttg
gccctctgtatgttcttgatgcaggtgggtgaccgagttgtctattacgttcagtatgac
catgtcaccatgctggatgagcgcaatgcacccaacatgaccttcccagccatcactctc
tgcaacttcaacaccttccgtcgttcccaggttagctacagcgacctgctctttatggga
ccactcatagggtatgaggacaacatggcacctgggttccagcttgcccccgagcctgat
cgccaaggtgcccggttcagcatggccgagttctataaccggacacggcatcgtatggag
gacattcttctggagtgcacatttgctggaaaggattgtggtcctgagcactggagagag
atcttcactcgatatggcaaatgctacacattcaactctggccaggatggacagccactg
cgcgtcaccacgaaagggggtatgggcaacggcctggaactaatgctggacattcaacag
gacgagtacctgccagtgtggggagagacagatgagacgtcttttgaagccggcatcaaa
gtgcagatccacactcaggacgagccgcctttcattgatcagctgggattcggagtggcg
ccaggctttcagacgtttgtgtcttgccaggagcagaggttgacctacctgccccctcca
tggggcgactgcaggtccgagcccattgactcggacttctttaccacctacagcatcact
gcgtgccgcatcgactgtgagacgcgctacctggtagagaactgtaactgtcgcatggtt
catatgcccggagatgctccatactgcacgccggaacagtataaagagtgtgcagatcca
gctttggatttcctggtggagagagacaatgattactgtgtgtgtgaaacaccctgcaac
atgacgcgctacggcaaagagttgtccttcgtcaagatccccagcaaggcttcagccaaa
tacctggccaagaagttcaacaagacagagcagtacattgcggataacatcttggttctg
gatatctattttgaggctttgaactatgagactattgagcagaaaaaggcctatgagctg
cctggattactgggtgatattggtggtcagatgggtctttttatcggagccagtattctg
acagttttggagctctttgactatctttatgaggtgatcaagtacaagctgtgccgctgc
aggaagcagaaccagaaacgcagcaacaacaacgaccgaggagccgtgctgagcctggac
aacgtgcagtgccatcctccctgtgaaaacctgcgcactccctctacgtatccggccaac
atcctacctcaccatccagggcagggcaacttcgaggacttcacctgctga

DBGET integrated database retrieval system