KEGG   Ictalurus punctatus (channel catfish): 108255533Help
Entry
108255533         CDS       T04658                                 

Definition
(RefSeq) transmembrane protein 150A-like
  KO
K21846  transmembrane protein 150
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ipu04131]
    108255533
Membrane trafficking [BR:ipu04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    108255533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frag1 NOA36
Motif
Other DBs
NCBI-GeneID: 108255533
NCBI-ProteinID: XP_017307026
UniProt: A0A2D0PK76
Position
22
AA seq 278 aa AA seqDB search
MTAWIILPVSLAAFSITGIWIVYAMAVMNHHVCPVENWSYNETCSEEKAERGFPKTCCTI
QHIPLISKCGSFPPESCLFSLIGNVGAFMVVMVCLLRYAQIIEHSQHCWTNTSSLMCGFI
NAVGLVMVGNFQVDHAKTLHYVGAGVAFPAGMVFVCLQCVLTYRVAVTPLDYLMAHVRVA
LAIGSLIALVLSGAFFIHESFVLQHAAAICEWVFTVLILVFYGTFTYEFGSVTRDTLMAG
IQRNLPLGGGASRELKAPGRSSTTSTQLNCMPENIAML
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtggatcatcctgcccgtcagcctggccgccttctccatcaccgggatatgg
atagtgtatgccatggccgttatgaaccaccacgtttgtcctgtggagaactggtcctat
aacgagacgtgttcagaggaaaaggctgaacggggcttccccaaaacctgctgcaccatc
cagcacatcccactcatcagtaaatgcggctcatttcctccagagagctgtctgttcagc
ctcatcggcaatgtgggagcctttatggtggtgatggtgtgtctgctgcgctatgctcag
atcatagagcacagtcagcactgttggaccaacacgagcagcctgatgtgcggcttcatc
aacgccgtgggactcgtcatggtggggaacttccaggtggaccacgctaagactctgcac
tacgtgggtgcgggcgtggcgtttcccgcgggcatggtgttcgtgtgtctgcagtgcgtg
ctgacgtaccgtgtcgccgtcacgcctctcgattacctgatggcccacgtgagggtggcg
ctcgccatcggctctctgatcgccctcgtcctcagcggcgccttcttcatccacgagagc
ttcgtcctgcagcacgccgccgccatctgcgagtgggtcttcaccgtcctcatcctcgtc
ttctacggcacgttcacctacgagttcggctccgtcaccagagacaccctgatggccggt
atacagaggaacctccccctcgggggcggggcttccagggagctcaaggctccgggccgg
agcagcaccacatctacacagctgaactgcatgcccgagaacatagctatgctttaa

DBGET integrated database retrieval system