KEGG   Ictalurus punctatus (channel catfish): 108255631Help
Entry
108255631         CDS       T04658                                 

Definition
(RefSeq) tankyrase-1-like
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ipu03032]
    108255631
   03036 Chromosome and associated proteins [BR:ipu03036]
    108255631
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108255631
DNA replication proteins [BR:ipu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108255631
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     108255631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank Ank_5 Ank_2 Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 108255631
NCBI-ProteinID: XP_017307208
UniProt: A0A2D0PKR5
Position
22
AA seq 1226 aa AA seqDB search
MAVSRRSSQHHGALPSPPRGALLVSPPPETPAVSPDSAGLSPAESGPAVEVVVVVPAASP
GRPAPAVCAQGAGAAGEEDEDDEEESCGAGGAFRELFEACRNGDVSRVKRLVDSVNVNAK
DVSGRKSTPLHFAAGFGRKDVVEHLLRTGANVHARDDGGLIPLHNACSFGHAEVVSVLLC
QGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKSVL
TGEYKKDELLEAARSGNEDKLMALLTPLNVNCHASDGRKSTSQKMLSTPLHLAAGYNRVR
IVQLLLQYGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAA
SKNRAEVCSLLLSHGADPTVLNCHGKSAIELAHTPELRDRLAYEFKGHSLLQAAREADMT
KVKKVPPDIINFKHPHSQDSALHCAVASPHPKRKQATELLLRKGANIHEKNKDFMTAFHM
AAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCRLLLSYGADPSIISLQG
FTAAQMGNEAVQQILSENIPTRNSDADYRFLEAAKAGDLDTVKQLCCPQNVNCRDLEGRH
STPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVN
VADLWKFTPLHEAAAKGKYEICKLLLKHGADPSKKNRDGNVALDMVKDGDTDIQDLLRGD
AALLDAAKKGCLARVQKLCSSDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVN
AQDKGGLIPLHNAASYGHVDIAALLIKFNTCVNATDKWAFTPLHEAAQKGRTQLCALLLA
HGADPTMKNQEGQTALDLATADDIRALLMDAMPPDSLPSCLKPQATVLSASLISPASSID
NLSDGACGGADGATGTERKEGEVAMLDMNISQFLNSLGLEHLRDIFEREQITLDVLADMG
HEELKEIGINAYGHRHKLLKGLERLLGGQQGANPYLAFHCTAQGTVLIDLPPDDKEFQSV
EEEMQSTIREHRDGGNAGGVFNRYNIIKIQKVVNKKLRERYAHRQKEISDENHNHQNERM
LFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRS
CYVCHRQMLFCRVTLGKSFLQFSAMKMAHAPPAHHSVIGRPSVNGLAYAEYVIYRGEQAF
PEYLITYQIAKPESNTQSSTGAQQKS
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcacgtcgctcttctcagcatcacggagcgctgccttctcctccgcgcggc
gccctgctcgtctctcctccgccggagactcccgcagtgagcccggactcggcgggtttg
agtccggcggagagcggcccagcggtggaggtggtggtggtggttcccgcggcctctccg
ggccgccccgctccggctgtgtgcgctcagggcgccggcgctgcgggggaggaggacgag
gacgacgaggaggagagctgcggagccgggggagcgttccgcgagctgttcgaggcctgc
aggaacggagacgtgtcacgggtcaagcggctggtggactcggtgaatgtgaacgctaag
gacgtgtccgggaggaagtccactccgctgcacttcgccgcaggttttggtcgtaaggat
gtggtggagcatctcctgcgtacaggagcgaatgttcatgcccgtgatgacggaggtctg
attcctctgcacaacgcgtgttcgtttggtcacgccgaggtggtgagcgtgttactgtgt
cagggtgccgaccccaatgcccgcgacaactggaactacacgccgctgcacgaggccgcc
atcaagggcaagatcgacgtgtgtatcgtcctcctccagcatggcgctgaccccaacatc
agaaatactgatggcaaatcagctctggacctggcagacccttcagccaagagtgtgctc
actggtgagtataagaaggacgagctgttggaggcagcgaggagtggaaatgaagataag
ttgatggctcttcttacaccactcaatgtcaactgtcacgccagcgatggacgcaagtca
acttcacaaaaaatgctgtcaactccactgcacctggccgcaggttataaccgcgtacgc
atcgtccagctgctgctgcagtacggagcagacgtccacgccaaggacaagggaggtctg
gttcctctccataacgcctgctcgtacggtcactatgaggtcactgagctgctgctgaag
cacggggcatgtgtgaacgcgatggacctgtggcagttcacacccctgcacgaggcggcc
agtaagaaccgggcggaggtgtgttcactgctgctgagtcacggcgccgaccccaccgta
ctcaactgtcacggcaagagcgccatcgagctcgcacacacccctgaactccgcgacaga
ctcgcctatgagttcaaaggtcactccctgctccaggctgcgcgcgaggccgacatgacg
aaggtgaaaaaggttccaccagacatcatcaacttcaaacaccctcactctcaggacagc
gcactgcattgtgctgtggcgtctcctcatcctaaacgcaaacaggcgacagaactgctg
ctgcgcaaaggagccaacatccacgagaagaacaaagatttcatgactgcgttccacatg
gctgcagaacgagctcataacgacgtgttggaggttctgcagaaacacggagcgaaggtg
aacgcagtggacactctgggtcagacggcgctgcacagagccgctctggccggtcacatc
cagacctgtcggctgttgcttagctatggcgccgacccgtcaatcatctctctccaaggt
ttcaccgcggctcagatgggcaacgaagccgtgcagcagatcctcagcgagaacattcca
actcgaaactctgacgcagactatcgcttccttgaggcagcaaaagcaggagacctcgac
accgtgaagcaactgtgctgtcctcagaacgtgaactgtcgtgacctggaaggacgtcac
tccactccgctgcacttcgctgctggttataaccgtgtggcagtggtggagtatttactg
cagcacggagctgacgtacacgccaaggacaagggaggtctggttcctctccataacgcc
tgctcgtacggtcactatgaagtagctgagttgttggtgcgtcatggagcatcggtgaac
gtagctgatctgtggaagttcactccactgcacgaagctgctgccaagggcaaatatgag
atctgtaaactgctgctcaaacatggtgctgacccgtcaaagaagaaccgggacggtaac
gtggctctggacatggtgaaggacggggacacagacatccaggacctcctgcgtggagac
gccgccctgctggacgccgccaagaagggctgccttgcccgcgtccagaaactgtgctct
agtgataacatcaactgtagagacacgcaggggaggaactctacacccttacacctcgca
gctggctacaataacctggaggtggcggagtacctgttggagcacggtgcggatgtgaat
gcgcaggataaaggaggtcttatcccgctgcacaacgccgcctcctatgggcatgtggac
atagcagctctgttgatcaagttcaacacatgtgtgaacgcgacggataagtgggccttc
acgccgctgcacgaggccgctcagaaagggaggacgcagctgtgtgcgctgctgctggct
cacggtgccgatcccaccatgaagaaccaggagggacagaccgcgctggacttagccacg
gcggatgatatccgtgctctgctgatggacgccatgcctcctgactctctgcccagctgt
ctgaaacctcaggccacagtgctgagtgccagtctgatctcccccgcctccagcatcgac
aacctgagtgatggggcgtgtgggggggccgacggggccacggggactgagcgcaaggaa
ggagaggtggccatgttggatatgaacatcagtcagttcctgaacagtctgggtctcgaa
cacctccgagatatattcgagcgggaacagatcactctggatgtactggctgatatggga
cacgaggagctcaaggagatcgggataaacgcttatggacacagacacaaactactcaaa
ggcctcgagaggctgctggggggtcagcagggtgcgaatccgtacctggcctttcactgc
accgctcagggcaccgtgctcatcgacctgcctcctgacgacaaggagttccagtctgtg
gaggaggagatgcagagcacgatccgcgagcacagagatggaggaaatgcaggaggagtt
tttaatcgatacaacatcatcaagatccagaaggtggtgaataagaagctgcgtgagcgt
tacgcacaccgccagaaggagatctctgacgagaaccataaccaccagaacgagcgcatg
ctgttccacggttctcccttcatcaacgccatcatccataaaggcttcgatgagcgccac
gcctacatcggcggcatgttcggagccgggatctacttcgcggaaaactcctccaaaagt
aaccagtacgtctacggcatcggaggggggacgggatgccccacccacaaagaccgctcc
tgttacgtgtgccacaggcagatgctgttctgcagggtgactctggggaagtcgttcctg
cagttcagtgcgatgaagatggctcacgctcctcctgctcaccactccgtgatcgggagg
cccagtgtgaacggcctggcttacgccgagtacgtcatctacaggggagagcaggcgttt
ccagaatatctcatcacctaccagatcgcaaaaccagagagcaacacacagagcagcaca
ggagcacaacagaaatcatag

DBGET integrated database retrieval system