KEGG   Ictalurus punctatus (channel catfish): 108256088
Entry
108256088         CDS       T04658                                 

Gene name
ahrr
Definition
(RefSeq) Aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108256088 (ahrr)
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108256088 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 108256088
NCBI-ProteinID: XP_017308115
UniProt: W5UBJ8
Position
23
AA seq 654 aa
MIPPGDCMYAGRKRRKPIQKHRKPAPVSEKSNPSKRHRDRLNTELDRLASLLPFPPEIIS
KLDKLSVLRLSVSYLRVKSYFNASQEKQLMKHLSPPSINDIMVETMSPVPCTSESELLLE
SLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNFFDYIHVDDRQEFRQQLHWSMNP
SMTSDQDSATGNGEDFVLSSLFHSQNAAGVPPEFSSFLNRCFISRVRCLLDSTSGFLTMQ
FQGHLKFLYGQKKTASGTSLPPQLALFCVAMPLCFSSITDMKMKNTIRGKHKITGNNMII
DHSDREQHSRRHSVMNEGRDTLFLNSSTPVATLLHHTPWAPFSKENVKFKIEDYYGKEEP
LNICKDSLGSQKVPHLDTTWPPRGSYGPFCTGHGVNLLLGGRVSKHGHYGKPYKISPMYY
NSTTELYIPKIYGSLPPQEVVEGNYVDSNKSENACHEEQRQVYDAHLIAELPIKVEHDSD
AENERDFYDQAWTAQEHNNSSYDGLQMKAEDSYYEQYIPCQKSTGSNGQLYNNQYPNAFG
ATTQPLKCILDKDPEYLRPQRLGHVHPLNSSQSANCMDSYNDGTMEHKGSIHQNYKLGYQ
LKGQGLLHSIKREPMDSPPWHVNEYEQIVGQWNMMPNCRLNLGEPKANPYVFMQ
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgataccaccgggagactgcatgtatgcaggtcggaaacggaggaagcccatacagaag
catagaaagcctgcacctgtaagcgagaagtccaacccgtcaaaacggcacagagaccgg
ctgaatacagagctagatcggctggccagtctgctacctttcccacctgagatcatctcc
aaactggacaagctttctgtgctgcgtctcagtgtcagttatcttcgtgtcaagagctac
ttcaatgccagtcaagagaagcagttgatgaagcacctcagccctccgtccattaatgac
atcatggttgaaactatgtcacctgtgccttgtacatctgagagtgagctgctgctggag
tccctaacaggctttgctcttgttgtgagcagtgatggaatggtcttctatgcttcctct
actatagtggactatctgggcttccatcagactgatgtgatgcaccagaacttctttgac
tacattcacgtagatgataggcaggagttcaggcaacagctccactggtccatgaatccc
tcaatgacctctgatcaggattcagccacaggaaatggtgaggactttgtgcttagcagt
ttattccactcccagaatgcagctggtgttcctccagagttttcttccttccttaaccgg
tgtttcatctcgagagtgcgctgtctgctggacagcacctcaggatttcttactatgcaa
ttccagggtcatctaaagttcttgtatggacagaagaagacggcatctggcacttcctta
cccccacagcttgctctgttctgtgtggccatgcctctgtgcttttcctccatcacagac
atgaagatgaaaaacacaataaggggcaagcacaaaatcacaggcaataacatgatcata
gatcatagtgacagagaacagcactcaagaaggcactcagtgatgaatgaaggcagagac
acactctttctgaattcttccactccagtagccaccttactccaccatacaccctgggca
ccattttccaaagaaaatgtcaaattcaagattgaagactactatggtaaggaagagcct
cttaacatctgcaaggactctttaggtagccagaaagtccctcatttggacacaacatgg
cctcccagaggctcttatgggcccttctgcactggtcatggagtcaacttgttgcttggt
ggtagagtaagcaagcatggtcactatgggaagccctacaaaatatccccaatgtattac
aacagcacaacggagctttatattccaaagatctatgggagtcttccaccccaagaagtg
gtggaaggtaattatgtggacagcaacaaaagtgaaaatgcctgtcatgaggaacaaaga
caagtctatgatgcacatctgatagctgagttaccaatcaaggtagagcatgactctgat
gctgaaaacgaacgtgacttttatgaccaggcctggacagcccaagagcataataacagc
tcttatgatggcctacaaatgaaagcagaagatagttactatgaacagtacataccttgc
caaaaaagcacagggagtaatggacaattgtacaataaccagtacccaaatgcctttgga
gcaactacacaacctctaaagtgcatccttgataaagatccagaatatctccgtccccag
aggttgggacatgtacacccactcaacagtagccaaagtgctaactgtatggacagctac
aatgatgggactatggaacacaagggctccatacatcaaaattacaaacttggctatcag
ctcaaaggacaaggactgcttcattccatcaagcgcgagcctatggattctccaccctgg
catgtaaatgaatatgaacagatagttgggcaatggaatatgatgccaaattgcagattg
aatctaggggagcccaaagctaatccatatgtctttatgcaataa

DBGET integrated database retrieval system